Simc does not support overlapping add spawning in a single raid event (duration of 45.000s > reasonable minimum cooldown of 15.000s).

close

SimulationCraft 715-01

for World of Warcraft 7.1.5 Live (wow build level 23360, git build f586d81)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-12-18 Incorrect spell level for starfall damage component.
Starfall spell_level 40.00 76.00

Horrific Appendages

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-09 In-game testing shows that the actual rppm is much closer to 1.3~ than 0.7, so we slightly underestimated down to 1.25.
Horrific Appendages rppm 1.25 0.70

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-11-30 Reverse the incorrect AC mana cost adjustment from 60& back to 120%
Arcane Charge (effect#2) base_value 120.00 60.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 7.1.5 removed damage information.
Mark of the Distant Army scaling_class -1.00 0.00
2017-01-10 7.1.5 removed damage information.
Mark of the Distant Army (effect#1) delta 0.15 0.00
2017-01-10 7.1.5 removed damage information.
Mark of the Distant Army (effect#1) average 8.83 0.00

Table of Contents

Raid Summary

 

Raid Event List
0 adds,name=Pack_Beast,count=6,first=15,duration=10,cooldown=30,angle_start=0,angle_end=360,distance=3
1 adds,name=Heavy_Spear,count=2,first=15,duration=15,cooldown=20,spawn_x=-15,spawn_y=0,distance=15
2 movement,first=13,distance=5,cooldown=20,players_only=1,player_chance=0.1
3 adds,name=Beast,count=1,first=10,duration=45,cooldown=75,last=195,duration_stddev=5,cooldown_stddev=10

Actions per Minute / DPS Variance Summary

BD/ELT/SH/Sac/CDF : 786155 dps, 386767 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
786155.0 786155.0 784.9 / 0.100% 156869.1 / 20.0% 20.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
32683.4 32683.4 Mana 0.00% 53.1 100.0% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Sacrifice
  • 100: Channel Demonfire (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
BD/ELT/SH/Sac/CDF 786155
Channel Demonfire 0 (103342) 0.0% (13.2%) 21.6 14.09sec 1438113 638632

Stats details: channel_demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.58 0.00 320.40 0.00 2.2519 0.1346 0.00 0.00 0.00 638632.41 638632.41
 
 

Action details: channel_demonfire

Static Values
  • id:196447
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:52800.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.immolate.remains>cast_time
Spelldata
  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Channel Demonfire (_tick) 103342 13.2% 0.0 0.00sec 0 0 Direct 664.9 40965 81949 46681 13.9%  

Stats details: channel_demonfire_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 664.93 0.00 0.00 0.0000 0.0000 31039450.88 31039450.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 572.19 86.05% 40965.03 18254 80790 41358.52 35242 52685 23439732 23439732 0.00
crit 92.74 13.95% 81948.94 36510 161581 82728.15 67045 111015 7599718 7599718 0.00
 
 

Action details: channel_demonfire_tick

Static Values
  • id:196448
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.640000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Chaos Bolt 139351 17.8% 43.5 6.74sec 962697 811143 Direct 53.5 0 782801 782801 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.49 53.49 0.00 0.00 1.1868 0.0000 41871227.31 41871227.31 0.00 811143.50 811143.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 53.49 100.00% 782800.50 511883 1132771 783216.47 701600 856496 41871227 41871227 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 50701 6.5% 36.5 8.28sec 417210 415377 Direct 46.1 195986 442445 330369 54.5%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.47 46.05 0.00 0.00 1.0044 0.0000 15214420.81 15214420.81 0.00 415376.78 415376.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.94 45.48% 195985.81 129236 285989 196042.17 170770 231167 4104511 4104511 0.00
crit 25.11 54.52% 442445.02 258507 651727 442587.00 380762 504129 11109910 11109910 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 8181 1.0% 20.4 1.47sec 118540 0 Direct 20.0 105734 211728 120495 13.9%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.36 20.03 0.00 0.00 0.0000 0.0000 2413721.02 2413721.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.24 86.07% 105733.79 87244 115162 105723.01 96342 113029 1823030 1823030 0.00
crit 2.79 13.93% 211728.32 174488 230324 201014.44 0 230324 590691 590691 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Demonic Power 118741 15.1% 144.8 2.07sec 246158 0 Direct 449.4 69593 139186 79306 14.0%  

Stats details: demonic_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.80 449.43 0.00 0.00 0.0000 0.0000 35642942.41 35642942.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 386.70 86.04% 69593.18 61705 81451 69579.23 66592 72553 26911935 26911935 0.00
crit 62.73 13.96% 139186.44 123410 162902 139159.67 131793 147248 8731007 8731007 0.00
 
 

Action details: demonic_power

Static Values
  • id:196100
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196100
  • name:Demonic Power
  • school:shadow
  • tooltip:
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 217238 27.7% 104.2 2.86sec 626817 595218 Direct 113.2 134610 269293 196451 45.9%  
Periodic 405.5 72791 145527 106180 45.9% 269.4%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.16 113.15 405.52 405.52 1.0531 1.9982 65287113.45 65287113.45 0.00 70965.10 595218.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.20 54.08% 134609.63 89659 198412 134590.92 124135 146370 8237588 8237588 0.00
crit 51.95 45.92% 269292.91 179319 396825 269276.34 243686 295897 13991084 13991084 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 219.4 54.10% 72790.69 24 107473 72785.80 69012 76519 15967848 15967848 0.00
crit 186.2 45.90% 145527.23 49 214945 145514.44 137332 153365 27090593 27090593 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 12774 1.6% 13.2 21.61sec 289817 336048 Direct 14.8 226808 453599 258623 14.0%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.19 14.78 0.00 0.00 0.8625 0.0000 3822543.16 3822543.16 0.00 336047.75 336047.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.71 85.97% 226807.86 159429 320736 227100.64 184384 274360 2882209 2882209 0.00
crit 2.07 14.03% 453598.61 318859 641387 398100.08 0 641366 940335 940335 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9541 1.2% 20.2 14.83sec 141575 0 Direct 20.2 124241 248649 141575 13.9%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.24 20.24 0.00 0.00 0.0000 0.0000 2865262.31 2865262.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.42 86.07% 124241.29 109698 144802 124220.35 114574 135751 2164119 2164119 0.00
crit 2.82 13.93% 248649.50 219396 289603 234538.14 0 289603 701144 701144 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Rain of Fire 18346 2.3% 3.9 43.41sec 1400203 1450012 Periodic 103.1 46811 93653 53338 13.9% 0.0%

Stats details: rain_of_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.93 0.00 0.00 103.09 0.9658 0.0000 5498445.17 5498445.17 0.00 1450011.91 1450011.91
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.7 86.07% 46811.32 31660 70057 45268.12 0 61334 4153181 4153181 0.00
crit 14.4 13.93% 93653.36 63325 140093 89731.69 0 134735 1345264 1345264 0.00
 
 

Action details: rain_of_fire

Static Values
  • id:5740
  • school:fire
  • resource:soul_shard
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
Spelldata
  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.
 
pet - infernal 152209 / 25915
Immolation 132096 2.8% 2.1 180.98sec 3207445 0 Periodic 159.2 36598 73185 41693 13.9% 16.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 40.04 159.21 0.0000 1.2194 6637829.56 6637829.56 0.00 135951.45 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 137.0 86.07% 36597.91 34281 41137 36601.80 35928 37387 5015245 5015245 0.00
crit 22.2 13.93% 73184.69 68561 82274 73188.93 68561 78846 1622584 1622584 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 20112 0.4% 40.0 5.44sec 25247 20705 Direct 40.0 22158 44287 25247 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.04 40.04 0.00 0.00 1.2194 0.0000 1010897.38 1486114.90 31.98 20704.50 20704.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.45 86.04% 22158.29 20500 24600 22158.12 21525 22778 763365 1122219 31.98
crit 5.59 13.96% 44287.09 41000 49200 44194.04 0 49200 247532 363896 31.91
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 185979 / 15762
Immolation 161660 1.7% 1.0 0.00sec 4041658 0 Periodic 92.8 38240 76492 43538 13.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.82 92.83 0.0000 1.0789 4041657.88 4041657.88 0.00 164161.57 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.0 86.15% 38239.88 34281 41137 38249.11 37390 39322 3058107 3058107 0.00
crit 12.9 13.85% 76492.28 68561 82274 76507.34 68561 82274 983550 983550 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24319 0.3% 22.8 1.08sec 26642 24695 Direct 22.8 23386 46763 26642 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.82 22.82 0.00 0.00 1.0789 0.0000 608000.47 893818.28 31.98 24695.39 24695.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.64 86.07% 23385.65 20500 24600 23386.61 22687 24144 459336 675267 31.98
crit 3.18 13.93% 46762.89 41000 49200 45191.06 0 49200 148665 218551 30.89
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 186139 / 15775
Immolation 161807 1.7% 1.0 0.00sec 4045330 0 Periodic 92.8 38242 76466 43578 14.0% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.82 92.83 0.0000 1.0789 4045329.71 4045329.71 0.00 164310.71 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.9 86.04% 38241.99 34281 41137 38251.39 37230 39249 3054436 3054436 0.00
crit 13.0 13.96% 76466.23 68561 82274 76475.82 68561 82274 990894 990894 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24332 0.3% 22.8 1.08sec 26657 24709 Direct 22.8 23384 46787 26657 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.82 22.82 0.00 0.00 1.0789 0.0000 608333.83 894308.35 31.98 24708.93 24708.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.63 86.01% 23383.67 20500 24600 23384.64 22806 24144 459002 674777 31.98
crit 3.19 13.99% 46787.30 41000 49200 45322.03 0 49200 149332 219532 30.97
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 186045 / 15768
Immolation 161742 1.7% 1.0 0.00sec 4043709 0 Periodic 92.8 38243 76456 43561 13.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.82 92.83 0.0000 1.0789 4043709.44 4043709.44 0.00 164244.90 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.9 86.08% 38242.82 34281 41137 38252.27 37294 39302 3056056 3056056 0.00
crit 12.9 13.92% 76455.88 68561 82274 76471.73 68561 82274 987654 987654 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24303 0.3% 22.8 1.08sec 26625 24679 Direct 22.8 23384 46779 26624 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.82 22.82 0.00 0.00 1.0789 0.0000 607598.22 893226.93 31.98 24679.05 24679.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.66 86.15% 23384.36 20500 24600 23385.29 22687 24307 459738 675858 31.98
crit 3.16 13.85% 46778.82 41000 49200 45187.27 0 49200 147860 217369 30.89
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 115364 / 15116
Shadow Bolt 115364 1.9% 3.3 78.63sec 1362322 0 Periodic 36.6 108138 216050 123140 13.9% 15.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 0.00 36.60 36.60 0.0000 1.2334 4507054.75 4507054.75 0.00 99841.72 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.5 86.10% 108138.39 69 126576 107725.25 0 126576 3407755 3407755 0.00
crit 5.1 13.90% 216049.97 219 253152 208479.01 0 253152 1099300 1099300 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 133603 / 6943
Chaos Bolt 133603 0.9% 3.3 77.45sec 631020 307031 Direct 3.3 0 631020 631020 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.30 3.30 0.00 0.00 2.0553 0.0000 2081363.43 2081363.43 0.00 307031.04 307031.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.30 100.00% 631019.69 600929 721115 630819.47 0 721115 2081363 2081363 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 242413 / 13458
Chaos Barrage 242413 1.7% 3.3 79.21sec 1207169 0 Periodic 115.0 30639 61265 34898 13.9% 6.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.33 0.00 115.04 115.04 0.0000 0.1575 4014682.68 4014682.68 0.00 221622.01 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.0 86.09% 30638.83 152 34809 30514.09 27710 34809 3034528 3034528 0.00
crit 16.0 13.91% 61264.72 304 69619 60958.96 0 69619 980154 980154 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
BD/ELT/SH/Sac/CDF
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:BD/ELT/SH/Sac/CDF
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.83sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 9.7 35.65sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.73 0.00 0.00 0.00 0.9915 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:BD/ELT/SH/Sac/CDF
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:BD/ELT/SH/Sac/CDF
  • harmful:false
  • if_expr:
 
Grimoire of Sacrifice 1.0 0.00sec

Stats details: grimoire_of_sacrifice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_of_sacrifice

Static Values
  • id:108503
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_sacrifice.enabled
Spelldata
  • id:108503
  • name:Grimoire of Sacrifice
  • school:shadow
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.
 
Havoc 10.7 28.35sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.75 0.00 0.00 0.00 1.0415 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 14.5 21.21sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.54 0.00 0.00 0.00 0.9832 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 3.0 120.98sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 2.1 180.98sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.8598 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.0 0.0 15.4sec 15.4sec 78.18% 78.18% 1.8(1.8) 19.2

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.35%
  • accelerando_2:24.10%
  • accelerando_3:14.47%
  • accelerando_4:6.76%
  • accelerando_5:3.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Backdraft 36.5 0.0 8.3sec 8.3sec 66.48% 46.39% 0.0(0.0) 18.5

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:15.99%
  • backdraft_2:50.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 180.8sec 180.8sec 6.87% 6.21% 0.0(0.0) 2.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 12.67% 0.0(0.0) 1.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 18.2 0.0 16.3sec 16.3sec 56.62% 46.96% 0.0(0.0) 0.6

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:56.62%

Trigger Attempt Success

  • trigger_pct:50.24%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.6sec 69.6sec 8.68% 8.68% 0.0(0.0) 3.2

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.68%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 21.1 23.4 14.6sec 6.7sec 41.13% 57.00% 23.4(23.4) 20.6

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:41.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 8.0 6.5 37.6sec 21.2sec 92.27% 91.71% 49.4(49.4) 7.1

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:92.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 99.09% 51.16% 0.0(0.0) 0.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:99.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.0sec 69.4sec 13.53% 13.53% 0.0(0.0) 3.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.53%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.17% 10.17% 0.0(0.0) 1.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 1.5 0.0 86.8sec 86.8sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:79.13%
Soul Harvest 3.0 0.0 121.0sec 121.0sec 18.33% 18.33% 0.0(0.0) 2.7

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:18.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Demonic Power

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • demonic_power_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196099
  • name:Demonic Power
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 75.4sec
chaos_tear 3.2 76.2sec
chaos_portal 3.3 75.6sec
dimension_ripper 0.6 107.6sec

Resources

Resource Usage Type Count Total Average RPE APR
BD/ELT/SH/Sac/CDF
channel_demonfire Mana 21.6 1139620.7 52800.0 52800.7 27.2
chaos_bolt Soul Shard 44.5 89.0 2.0 2.0 470537.8
havoc Mana 10.7 945980.2 88000.0 88000.8 0.0
immolate Mana 104.2 6874358.9 66000.0 66000.2 9.5
incinerate Mana 13.2 870463.7 66000.0 65996.6 4.4
rain_of_fire Soul Shard 3.9 11.8 3.0 3.0 466671.3
summon_infernal Soul Shard 2.1 2.1 1.0 1.0 0.0
Resource Gains Type Count Total Average Overflow
life_tap Mana 14.54 4439726.46 (49.16%) 305357.50 358288.13 7.47%
immolate Soul Shard 88.75 64.09 (62.45%) 0.72 24.65 27.78%
conflagrate Soul Shard 36.47 31.83 (31.01%) 0.87 4.64 12.72%
mp5_regen Mana 847.14 4591025.54 (50.84%) 5419.46 74598.81 1.60%
soulsnatcher Soul Shard 6.71 6.71 (6.53%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 0.00 15043.79
Mana 30024.89 32683.43
Soul Shard 0.34 0.34
Combat End Resource Mean Min Max
Mana 298504.79 563.56 1001178.43
Soul Shard 2.74 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.2%

Statistics & Data Analysis

Fight Length
Sample Data BD/ELT/SH/Sac/CDF Fight Length
Count 9999
Mean 300.78
Minimum 214.57
Maximum 375.75
Spread ( max - min ) 161.18
Range [ ( max - min ) / 2 * 100% ] 26.79%
DPS
Sample Data BD/ELT/SH/Sac/CDF Damage Per Second
Count 9999
Mean 786154.99
Minimum 665455.62
Maximum 951776.62
Spread ( max - min ) 286321.01
Range [ ( max - min ) / 2 * 100% ] 18.21%
Standard Deviation 40045.3299
5th Percentile 724582.11
95th Percentile 856254.49
( 95th Percentile - 5th Percentile ) 131672.38
Mean Distribution
Standard Deviation 400.4733
95.00% Confidence Intervall ( 785370.07 - 786939.90 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 100
0.1% Error 9968
0.1 Scale Factor Error with Delta=300 13689495
0.05 Scale Factor Error with Delta=300 54757980
0.01 Scale Factor Error with Delta=300 1368949480
Priority Target DPS
Sample Data BD/ELT/SH/Sac/CDF Priority Target Damage Per Second
Count 9999
Mean 386766.69
Minimum 334768.19
Maximum 454604.92
Spread ( max - min ) 119836.73
Range [ ( max - min ) / 2 * 100% ] 15.49%
Standard Deviation 16860.4627
5th Percentile 360476.99
95th Percentile 415638.17
( 95th Percentile - 5th Percentile ) 55161.18
Mean Distribution
Standard Deviation 168.6131
95.00% Confidence Intervall ( 386436.22 - 387097.17 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7301
0.1 Scale Factor Error with Delta=300 2426737
0.05 Scale Factor Error with Delta=300 9706947
0.01 Scale Factor Error with Delta=300 242673665
DPS(e)
Sample Data BD/ELT/SH/Sac/CDF Damage Per Second (Effective)
Count 9999
Mean 786154.99
Minimum 665455.62
Maximum 951776.62
Spread ( max - min ) 286321.01
Range [ ( max - min ) / 2 * 100% ] 18.21%
Damage
Sample Data BD/ELT/SH/Sac/CDF Damage
Count 9999
Mean 203655126.50
Minimum 137274437.73
Maximum 291700653.71
Spread ( max - min ) 154426215.99
Range [ ( max - min ) / 2 * 100% ] 37.91%
DTPS
Sample Data BD/ELT/SH/Sac/CDF Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data BD/ELT/SH/Sac/CDF Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data BD/ELT/SH/Sac/CDF Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data BD/ELT/SH/Sac/CDF Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data BD/ELT/SH/Sac/CDF Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data BD/ELT/SH/Sac/CDF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BD/ELT/SH/Sac/CDFTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data BD/ELT/SH/Sac/CDF Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 10.86 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 13.83 immolate,if=remains<=tick_time
F 88.61 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
G 2.08 berserking
0.00 blood_fury
0.00 arcane_torrent
0.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
H 22.04 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
I 9.11 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 12.43 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
K 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
L 1.07 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
M 2.96 soul_harvest
N 21.59 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
O 3.93 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 8.73 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 43.97 chaos_bolt
0.00 shadowburn
R 5.32 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
S 3.33 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
T 13.33 incinerate
U 1.11 life_tap

Sample Sequence

012689ABDEGHKMNPPTHQTCFHNQFRQFEFFFFFFHJNQCQHQQISCFFNHQQIQFFFFFFHJECFFNPQQQRSTNJTFFFFFFFFFCHNEPJQFFQNQRQSFFFFFFHJCFFNQMQREQTINQJFFFFFFFFECFHNPQJHFFOQNSQRTCFQIQQIFFFFFFIJEGNLCPQIQQHNFFFEFFFFFCHJNQQRQEFFTINTPFFFFFFHJCENQHQFMQIQTINSJTFFFFFFFFHCNQPEHJQFFNQHQTIQTFFFFIOONJCEHQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask BD/ELT/SH/Sac/CDF 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food BD/ELT/SH/Sac/CDF 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation BD/ELT/SH/Sac/CDF 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 8 grimoire_of_sacrifice Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
0:00.000 precombat 9 life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
0:00.000 precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 default D dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.102 default E immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.976 default G berserking Fluffy_Pillow 1034096.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:01.976 default H conflagrate Fluffy_Pillow 1034096.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:02.732 default K summon_infernal Fluffy_Pillow 1050844.3/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, backdraft(2), embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.487 default M soul_harvest Fluffy_Pillow 1067570.1/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.487 default N channel_demonfire Fluffy_Pillow 1067570.1/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:05.256 default P dimensional_rift Fluffy_Pillow 1053959.4/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, accelerando(2), potion_of_deadly_grace
0:06.011 default P dimensional_rift Fluffy_Pillow 1070685.2/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, accelerando(2), potion_of_deadly_grace
0:06.764 default T incinerate Fluffy_Pillow 1087391.5/1100000: 99% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, accelerando(3), potion_of_deadly_grace
0:07.519 default H conflagrate Fluffy_Pillow 1037124.1/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:08.274 default Q chaos_bolt Fluffy_Pillow 1054092.9/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, accelerando(3), potion_of_deadly_grace
0:09.306 default T incinerate Fluffy_Pillow 1077289.0/1100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:10.060 default C havoc Fluffy_Pillow_Beast1 1028478.4/1100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:10.815 default F immolate Fluffy_Pillow_Beast1 957690.6/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:11.572 default H conflagrate Fluffy_Pillow 908948.3/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:12.399 default N channel_demonfire Fluffy_Pillow 926097.1/1100000: 84% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:14.421 default Q chaos_bolt Fluffy_Pillow 911115.8/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:15.660 default F immolate Fluffy_Pillow_Pack_Beast1 934289.6/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:16.545 default R conflagrate Fluffy_Pillow 884842.4/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:17.432 default Q chaos_bolt Fluffy_Pillow 901432.5/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:18.186 default F immolate Fluffy_Pillow_Pack_Beast2 915535.0/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:19.073 default E immolate Fluffy_Pillow 866125.2/1100000: 79% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:19.960 default F immolate Fluffy_Pillow_Pack_Beast3 816715.3/1100000: 74% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:20.845 default F immolate Fluffy_Pillow_Pack_Beast4 767271.6/1100000: 70% mana | 3.0/5: 60% soul_shard bloodlust, backdraft, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:21.719 default F immolate Fluffy_Pillow_Pack_Beast5 717863.3/1100000: 65% mana | 3.0/5: 60% soul_shard bloodlust, backdraft, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:22.594 default F immolate Fluffy_Pillow_Pack_Beast6 668473.9/1100000: 61% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_deadly_grace
0:23.467 default F immolate Fluffy_Pillow_Heavy_Spear1 619046.5/1100000: 56% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, accelerando, potion_of_deadly_grace
0:24.342 default F immolate Fluffy_Pillow_Heavy_Spear2 569663.8/1100000: 52% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:25.202 default H conflagrate Fluffy_Pillow 520230.7/1100000: 47% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:26.063 default J life_tap Fluffy_Pillow 536816.8/1100000: 49% mana | 5.0/5: 100% soul_shard bloodlust, backdraft(2), lord_of_flames, accelerando(2), potion_of_deadly_grace
0:26.923 default N channel_demonfire Fluffy_Pillow 883383.7/1100000: 80% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, accelerando(2), potion_of_deadly_grace
0:28.796 default Q chaos_bolt Fluffy_Pillow 866713.0/1100000: 79% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, accelerando(3), potion_of_deadly_grace
0:29.982 default C havoc Fluffy_Pillow_Heavy_Spear2 890033.9/1100000: 81% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:30.896 default Q chaos_bolt Fluffy_Pillow 908153.1/1100000: 83% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(4)
0:31.651 default H conflagrate Fluffy_Pillow 923120.2/1100000: 84% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
0:32.487 default Q chaos_bolt Fluffy_Pillow 939693.0/1100000: 85% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:33.267 default Q chaos_bolt Fluffy_Pillow 954668.4/1100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:34.017 default I conflagrate Fluffy_Pillow 968798.0/1100000: 88% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:34.890 default S immolate Fluffy_Pillow 985370.6/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando
0:35.763 default C havoc Fluffy_Pillow_Heavy_Spear2 936040.2/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando(2)
0:36.624 default F immolate Fluffy_Pillow_Heavy_Spear2 864626.4/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando(2)
0:37.485 default F immolate Fluffy_Pillow_Heavy_Spear1 815304.9/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando(3)
0:38.334 default N channel_demonfire Fluffy_Pillow 765897.5/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, accelerando(3)
0:40.258 default H conflagrate Fluffy_Pillow 750699.6/1100000: 68% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando(3)
0:41.137 default Q chaos_bolt Fluffy_Pillow 763914.2/1100000: 69% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(3)
0:42.678 default Q chaos_bolt Fluffy_Pillow 787109.9/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:43.591 default I conflagrate Fluffy_Pillow 801032.4/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:44.677 default Q chaos_bolt Fluffy_Pillow 817593.1/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando(4)
0:45.589 default F immolate Fluffy_Pillow_Pack_Beast1 831500.4/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(4)
0:46.735 default F immolate Fluffy_Pillow_Pack_Beast2 782043.5/1100000: 71% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, embrace_chaos
0:47.885 default F immolate Fluffy_Pillow_Pack_Beast3 732589.0/1100000: 67% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, embrace_chaos
0:49.034 default F immolate Fluffy_Pillow_Pack_Beast4 683120.2/1100000: 62% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos
0:50.185 default F immolate Fluffy_Pillow_Pack_Beast6 633680.1/1100000: 58% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
0:51.337 default F immolate Fluffy_Pillow_Pack_Beast5 584254.4/1100000: 53% mana | 3.0/5: 60% soul_shard lord_of_flames
0:52.486 default H conflagrate Fluffy_Pillow 534785.5/1100000: 49% mana | 3.0/5: 60% soul_shard lord_of_flames
0:53.635 default J life_tap Fluffy_Pillow 551349.6/1100000: 50% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
0:54.769 default E immolate Fluffy_Pillow 897909.1/1100000: 82% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
0:55.903 default C havoc Fluffy_Pillow_Heavy_Spear2 848468.6/1100000: 77% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
0:57.034 default F immolate Fluffy_Pillow_Heavy_Spear2 776984.3/1100000: 71% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
0:58.169 default F immolate Fluffy_Pillow_Heavy_Spear1 727558.3/1100000: 66% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
0:59.301 default N channel_demonfire Fluffy_Pillow 678088.6/1100000: 62% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
1:01.822 default P dimensional_rift Fluffy_Pillow 662102.1/1100000: 60% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:02.955 default Q chaos_bolt Fluffy_Pillow 678647.0/1100000: 62% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:05.219 default Q chaos_bolt Fluffy_Pillow 712010.0/1100000: 65% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:06.558 default Q chaos_bolt Fluffy_Pillow 731388.1/1100000: 66% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:07.938 default R conflagrate Fluffy_Pillow 751242.7/1100000: 68% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:09.091 default S immolate Fluffy_Pillow 767831.4/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
1:10.240 default T incinerate Fluffy_Pillow 718530.7/1100000: 65% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:11.193 default N channel_demonfire Fluffy_Pillow 666447.1/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:13.322 default J life_tap Fluffy_Pillow 645162.9/1100000: 59% mana | 1.0/5: 20% soul_shard raid_movement, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:14.440 default T incinerate Fluffy_Pillow 991729.8/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:15.379 default F immolate Fluffy_Pillow_Heavy_Spear1 939644.2/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:16.497 default F immolate Fluffy_Pillow_Pack_Beast1 890211.1/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:17.614 default F immolate Fluffy_Pillow_Pack_Beast2 840764.0/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:18.714 default F immolate Fluffy_Pillow_Pack_Beast3 791301.0/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:19.817 default F immolate Fluffy_Pillow_Pack_Beast4 741884.4/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
1:20.904 default F immolate Fluffy_Pillow_Pack_Beast5 692513.3/1100000: 63% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(5)
1:22.012 default F immolate Fluffy_Pillow_Pack_Beast6 643052.3/1100000: 58% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:23.163 default F immolate Fluffy_Pillow_Heavy_Spear2 593612.2/1100000: 54% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:24.313 default F immolate Fluffy_Pillow_Beast1 544157.8/1100000: 49% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:25.463 default C havoc Fluffy_Pillow_Beast1 494703.3/1100000: 45% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:26.612 default H conflagrate Fluffy_Pillow 423234.4/1100000: 38% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:27.763 default N channel_demonfire Fluffy_Pillow 439794.3/1100000: 40% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos
1:30.427 default E immolate Fluffy_Pillow 425830.5/1100000: 39% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
1:31.559 default P dimensional_rift Fluffy_Pillow 376360.8/1100000: 34% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
1:32.686 default J life_tap Fluffy_Pillow 392900.4/1100000: 36% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
1:33.802 default Q chaos_bolt Fluffy_Pillow 739437.7/1100000: 67% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
1:35.365 default F immolate Fluffy_Pillow_Heavy_Spear1 762598.7/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:36.483 default F immolate Fluffy_Pillow_Heavy_Spear2 713165.6/1100000: 65% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:37.600 default Q chaos_bolt Fluffy_Pillow 663717.7/1100000: 60% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:38.943 default N channel_demonfire Fluffy_Pillow 683618.7/1100000: 62% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:41.445 default Q chaos_bolt Fluffy_Pillow 667473.4/1100000: 61% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:42.824 default R conflagrate Fluffy_Pillow 687313.7/1100000: 62% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:43.974 default Q chaos_bolt Fluffy_Pillow 703859.2/1100000: 64% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos
1:44.942 default S immolate Fluffy_Pillow 717786.2/1100000: 65% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
1:46.094 default F immolate Fluffy_Pillow_Pack_Beast1 668360.5/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
1:47.243 default F immolate Fluffy_Pillow_Pack_Beast2 618891.7/1100000: 56% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
1:48.392 default F immolate Fluffy_Pillow_Pack_Beast3 569555.4/1100000: 52% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
1:49.527 default F immolate Fluffy_Pillow_Pack_Beast4 520129.5/1100000: 47% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, accelerando
1:50.660 default F immolate Fluffy_Pillow_Pack_Beast5 470674.4/1100000: 43% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:51.794 default F immolate Fluffy_Pillow_Pack_Beast6 421236.9/1100000: 38% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:52.911 default H conflagrate Fluffy_Pillow 371789.0/1100000: 34% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:54.028 default J life_tap Fluffy_Pillow 388341.0/1100000: 35% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
1:55.145 default C havoc Fluffy_Pillow_Heavy_Spear1 734893.1/1100000: 67% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
1:56.262 default F immolate Fluffy_Pillow_Heavy_Spear1 663445.1/1100000: 60% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
1:57.379 default F immolate Fluffy_Pillow_Heavy_Spear2 613997.2/1100000: 56% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
1:58.497 default N channel_demonfire Fluffy_Pillow 564564.1/1100000: 51% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
2:01.089 default Q chaos_bolt Fluffy_Pillow 549990.9/1100000: 50% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:03.321 default M soul_harvest Fluffy_Pillow 583065.4/1100000: 53% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:03.487 default Q chaos_bolt Fluffy_Pillow 585525.2/1100000: 53% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:04.826 default R conflagrate Fluffy_Pillow 605366.9/1100000: 55% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:05.945 default E immolate Fluffy_Pillow 621948.6/1100000: 57% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:07.063 default Q chaos_bolt Fluffy_Pillow 572684.3/1100000: 52% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:07.988 default T incinerate Fluffy_Pillow 586590.4/1100000: 53% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:08.915 default I conflagrate Fluffy_Pillow 534526.6/1100000: 49% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:10.015 default N channel_demonfire Fluffy_Pillow 551063.6/1100000: 50% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:12.490 default Q chaos_bolt Fluffy_Pillow 535775.9/1100000: 49% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
2:14.052 default J life_tap Fluffy_Pillow 558922.1/1100000: 51% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:15.168 default F immolate Fluffy_Pillow_Heavy_Spear2 905459.3/1100000: 82% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:16.285 default F immolate Fluffy_Pillow_Pack_Beast1 856012.3/1100000: 78% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:17.385 default F immolate Fluffy_Pillow_Pack_Beast2 806549.3/1100000: 73% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:18.485 default F immolate Fluffy_Pillow_Pack_Beast3 757086.2/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:19.586 default F immolate Fluffy_Pillow_Pack_Beast4 707640.2/1100000: 64% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4)
2:20.673 default F immolate Fluffy_Pillow_Pack_Beast5 658217.2/1100000: 60% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5)
2:21.744 default F immolate Fluffy_Pillow_Pack_Beast6 608779.7/1100000: 55% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5)
2:22.815 default F immolate Fluffy_Pillow_Heavy_Spear1 559342.2/1100000: 51% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5)
2:23.885 default E immolate Fluffy_Pillow 509889.3/1100000: 46% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5)
2:25.010 default C havoc Fluffy_Pillow_Beast1 460419.8/1100000: 42% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
2:26.162 default F immolate Fluffy_Pillow_Beast1 388994.1/1100000: 35% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
2:27.312 default H conflagrate Fluffy_Pillow 339550.6/1100000: 31% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:28.446 default N channel_demonfire Fluffy_Pillow 356110.1/1100000: 32% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
2:31.015 default P dimensional_rift Fluffy_Pillow 340824.5/1100000: 31% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
2:32.148 default Q chaos_bolt Fluffy_Pillow 357369.4/1100000: 32% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
2:33.733 default J life_tap Fluffy_Pillow 380514.7/1100000: 35% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
2:34.867 default H conflagrate Fluffy_Pillow 727074.1/1100000: 66% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:36.000 default F immolate Fluffy_Pillow_Heavy_Spear1 743619.0/1100000: 68% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:37.131 default F immolate Fluffy_Pillow_Heavy_Spear2 694134.7/1100000: 63% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:38.265 default O rain_of_fire Fluffy_Pillow 644695.3/1100000: 59% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
2:39.019 default Q chaos_bolt Fluffy_Pillow 655868.3/1100000: 60% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
2:40.047 default N channel_demonfire Fluffy_Pillow 670812.8/1100000: 61% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:41.825 default S immolate Fluffy_Pillow 643825.7/1100000: 59% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:42.580 default Q chaos_bolt Fluffy_Pillow 588850.7/1100000: 54% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:43.476 default R conflagrate Fluffy_Pillow 601934.8/1100000: 55% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:44.231 default T incinerate Fluffy_Pillow 612959.8/1100000: 56% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:44.986 default C havoc Fluffy_Pillow_Heavy_Spear2 557984.9/1100000: 51% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:45.765 default F immolate Fluffy_Pillow_Pack_Beast1 481360.4/1100000: 44% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:46.520 default Q chaos_bolt Fluffy_Pillow 426385.5/1100000: 39% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:47.275 default I conflagrate Fluffy_Pillow 437410.5/1100000: 40% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:48.030 default Q chaos_bolt Fluffy_Pillow 448435.6/1100000: 41% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:48.785 default Q chaos_bolt Fluffy_Pillow 459460.6/1100000: 42% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:49.540 default I conflagrate Fluffy_Pillow 470485.7/1100000: 43% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:50.295 default F immolate Fluffy_Pillow_Pack_Beast5 481510.7/1100000: 44% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:51.632 default F immolate Fluffy_Pillow_Pack_Beast6 435190.4/1100000: 40% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
2:52.953 default F immolate Fluffy_Pillow_Pack_Beast2 388676.7/1100000: 35% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
2:54.306 default F immolate Fluffy_Pillow_Pack_Beast2 408142.9/1100000: 37% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, devils_due
2:55.663 default F immolate Fluffy_Pillow_Heavy_Spear1 427666.6/1100000: 39% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, devils_due
2:57.019 default F immolate Fluffy_Pillow_Heavy_Spear2 381336.5/1100000: 35% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, devils_due, accelerando
2:58.353 default I conflagrate Fluffy_Pillow 334816.6/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:59.487 default J life_tap Fluffy_Pillow 351376.0/1100000: 32% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
3:00.620 default E immolate Fluffy_Pillow 697920.9/1100000: 63% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
3:01.753 default G berserking Fluffy_Pillow 648465.8/1100000: 59% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
3:01.976 default N channel_demonfire Fluffy_Pillow 651722.2/1100000: 59% mana | 5.0/5: 100% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
3:04.107 default L summon_infernal Fluffy_Pillow 634708.4/1100000: 58% mana | 5.0/5: 100% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
3:05.092 default C havoc Fluffy_Pillow_Heavy_Spear1 651249.6/1100000: 59% mana | 5.0/5: 100% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
3:06.077 default P dimensional_rift Fluffy_Pillow 579790.8/1100000: 53% mana | 5.0/5: 100% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:07.049 default Q chaos_bolt Fluffy_Pillow 596354.7/1100000: 54% mana | 5.0/5: 100% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:08.988 default I conflagrate Fluffy_Pillow 629087.1/1100000: 57% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:09.990 default Q chaos_bolt Fluffy_Pillow 645665.8/1100000: 59% mana | 4.0/5: 80% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos
3:10.831 default Q chaos_bolt Fluffy_Pillow 659580.5/1100000: 60% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
3:11.674 default H conflagrate Fluffy_Pillow 673528.4/1100000: 61% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos
3:12.779 default N channel_demonfire Fluffy_Pillow 690078.3/1100000: 63% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos
3:15.342 default F immolate Fluffy_Pillow_Heavy_Spear2 674371.9/1100000: 61% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando
3:16.476 default F immolate Fluffy_Pillow_Pack_Beast1 624931.4/1100000: 57% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
3:17.611 default F immolate Fluffy_Pillow_Pack_Beast2 575505.5/1100000: 52% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
3:18.743 default E immolate Fluffy_Pillow 526038.6/1100000: 48% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:19.861 default F immolate Fluffy_Pillow_Pack_Beast3 476605.5/1100000: 43% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(2)
3:20.979 default F immolate Fluffy_Pillow_Pack_Beast4 427172.4/1100000: 39% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(2)
3:22.096 default F immolate Fluffy_Pillow_Pack_Beast5 377724.4/1100000: 34% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(2)
3:23.212 default F immolate Fluffy_Pillow_Pack_Beast6 328261.7/1100000: 30% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(2)
3:24.329 default F immolate Fluffy_Pillow_Heavy_Spear1 278813.7/1100000: 25% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(2)
3:25.448 default C havoc Fluffy_Pillow_Heavy_Spear2 229395.4/1100000: 21% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(2)
3:26.573 default H conflagrate Fluffy_Pillow 157959.6/1100000: 14% mana | 5.0/5: 100% soul_shard lord_of_flames
3:27.723 default J life_tap Fluffy_Pillow 174505.1/1100000: 16% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:28.873 default N channel_demonfire Fluffy_Pillow 521050.7/1100000: 47% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos
3:31.360 default Q chaos_bolt Fluffy_Pillow 505071.1/1100000: 46% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
3:32.921 default Q chaos_bolt Fluffy_Pillow 528202.5/1100000: 48% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:33.858 default R conflagrate Fluffy_Pillow 542087.2/1100000: 49% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:34.974 default Q chaos_bolt Fluffy_Pillow 558624.5/1100000: 51% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:35.913 default E immolate Fluffy_Pillow 572538.9/1100000: 52% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:37.030 default F immolate Fluffy_Pillow_Heavy_Spear1 523090.9/1100000: 48% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:38.148 default F immolate Fluffy_Pillow_Heavy_Spear2 473715.7/1100000: 43% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:39.249 default T incinerate Fluffy_Pillow 424267.8/1100000: 39% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:40.174 default I conflagrate Fluffy_Pillow 372173.9/1100000: 34% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:41.294 default N channel_demonfire Fluffy_Pillow 388739.5/1100000: 35% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames
3:43.805 default T incinerate Fluffy_Pillow 372066.3/1100000: 34% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames
3:44.772 default P dimensional_rift Fluffy_Pillow 319978.9/1100000: 29% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames
3:46.150 default F immolate Fluffy_Pillow_Pack_Beast1 339831.4/1100000: 31% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, accelerando
3:47.284 default F immolate Fluffy_Pillow_Pack_Beast2 290476.7/1100000: 26% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, accelerando(2)
3:48.401 default F immolate Fluffy_Pillow_Pack_Beast3 241028.8/1100000: 22% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(2)
3:49.520 default F immolate Fluffy_Pillow_Pack_Beast4 191648.2/1100000: 17% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(3)
3:50.622 default F immolate Fluffy_Pillow_Pack_Beast6 142215.2/1100000: 13% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(3)
3:51.724 default F immolate Fluffy_Pillow_Pack_Beast5 92782.3/1100000: 8% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(3)
3:52.825 default H conflagrate Fluffy_Pillow 43334.3/1100000: 4% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(3)
3:53.926 default J life_tap Fluffy_Pillow 59886.3/1100000: 5% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames, accelerando(3)
3:55.028 default C havoc Fluffy_Pillow_Heavy_Spear2 406453.4/1100000: 37% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(3)
3:56.124 default E immolate Fluffy_Pillow 335008.5/1100000: 30% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(4)
3:57.212 default N channel_demonfire Fluffy_Pillow 285599.7/1100000: 26% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(4)
3:59.590 default Q chaos_bolt Fluffy_Pillow 267714.5/1100000: 24% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames
4:01.201 default H conflagrate Fluffy_Pillow 290893.9/1100000: 26% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:02.335 default Q chaos_bolt Fluffy_Pillow 307453.4/1100000: 28% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:03.285 default F immolate Fluffy_Pillow_Heavy_Spear1 321325.9/1100000: 29% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:04.421 default M soul_harvest Fluffy_Pillow 271914.6/1100000: 25% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:04.421 default Q chaos_bolt Fluffy_Pillow 271914.6/1100000: 25% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:05.373 default I conflagrate Fluffy_Pillow 285816.4/1100000: 26% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:06.506 default Q chaos_bolt Fluffy_Pillow 302361.3/1100000: 27% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:07.458 default T incinerate Fluffy_Pillow 316263.9/1100000: 29% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:08.397 default I conflagrate Fluffy_Pillow 264178.4/1100000: 24% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:09.506 default N channel_demonfire Fluffy_Pillow 280735.5/1100000: 26% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando(3)
4:11.839 default S immolate Fluffy_Pillow 263417.5/1100000: 24% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, accelerando(4)
4:12.926 default J life_tap Fluffy_Pillow 213993.4/1100000: 19% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, accelerando(4)
4:14.063 default T incinerate Fluffy_Pillow 560583.7/1100000: 51% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames
4:15.030 default F immolate Fluffy_Pillow_Heavy_Spear1 508504.1/1100000: 46% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, accelerando
4:16.164 default F immolate Fluffy_Pillow_Pack_Beast1 459064.6/1100000: 42% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:17.283 default F immolate Fluffy_Pillow_Pack_Beast2 409646.3/1100000: 37% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:18.400 default F immolate Fluffy_Pillow_Pack_Beast3 360198.4/1100000: 33% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:19.519 default F immolate Fluffy_Pillow_Pack_Beast4 310780.1/1100000: 28% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:20.636 default F immolate Fluffy_Pillow_Pack_Beast5 261332.2/1100000: 24% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:21.754 default F immolate Fluffy_Pillow_Pack_Beast6 211899.0/1100000: 19% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:22.874 default F immolate Fluffy_Pillow_Heavy_Spear2 162501.2/1100000: 15% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3)
4:23.974 default H conflagrate Fluffy_Pillow 113042.2/1100000: 10% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4)
4:25.061 default C havoc Fluffy_Pillow_Heavy_Spear2 129618.2/1100000: 12% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, accelerando(4)
4:26.149 default N channel_demonfire Fluffy_Pillow 58209.3/1100000: 5% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(4)
4:28.451 default Q chaos_bolt Fluffy_Pillow 39257.4/1100000: 4% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames
4:30.061 default P dimensional_rift Fluffy_Pillow 62421.1/1100000: 6% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
4:31.211 default E immolate Fluffy_Pillow 78966.6/1100000: 7% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:32.362 default H conflagrate Fluffy_Pillow 29526.5/1100000: 3% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:33.513 default J life_tap Fluffy_Pillow 46086.5/1100000: 4% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos
4:34.663 default Q chaos_bolt Fluffy_Pillow 392632.0/1100000: 36% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames
4:36.271 default F immolate Fluffy_Pillow_Heavy_Spear2 416003.6/1100000: 38% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
4:37.405 default F immolate Fluffy_Pillow_Heavy_Spear1 366564.1/1100000: 33% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:38.161 default N channel_demonfire Fluffy_Pillow 311766.8/1100000: 28% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:39.939 default Q chaos_bolt Fluffy_Pillow 285592.1/1100000: 26% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:40.694 default H conflagrate Fluffy_Pillow 296942.5/1100000: 27% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:41.449 default Q chaos_bolt Fluffy_Pillow 308292.9/1100000: 28% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:42.204 default T incinerate Fluffy_Pillow 319643.3/1100000: 29% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:42.959 default I conflagrate Fluffy_Pillow 264993.7/1100000: 24% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:43.701 default Q chaos_bolt Fluffy_Pillow 276308.6/1100000: 25% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:44.456 default T incinerate Fluffy_Pillow 287821.8/1100000: 26% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:45.212 default F immolate Fluffy_Pillow_Pack_Beast1 233350.2/1100000: 21% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:45.966 default F immolate Fluffy_Pillow_Pack_Beast2 178848.1/1100000: 16% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:46.722 default F immolate Fluffy_Pillow_Pack_Beast3 124376.5/1100000: 11% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:47.493 default F immolate Fluffy_Pillow_Pack_Beast4 69857.0/1100000: 6% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:48.250 default I conflagrate Fluffy_Pillow 14780.8/1100000: 1% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:49.006 default O rain_of_fire Fluffy_Pillow 25820.5/1100000: 2% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, nefarious_pact, accelerando
4:49.760 default O rain_of_fire Fluffy_Pillow 36830.9/1100000: 3% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, devils_due, accelerando
4:51.095 default N channel_demonfire Fluffy_Pillow 56325.6/1100000: 5% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, devils_due, accelerando
4:53.977 default J life_tap Fluffy_Pillow 45610.6/1100000: 4% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames, devils_due, accelerando
4:55.311 default C havoc Fluffy_Pillow_Heavy_Spear2 395090.6/1100000: 36% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, devils_due, accelerando
4:56.645 default E immolate Fluffy_Pillow 326570.7/1100000: 30% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando
4:57.980 default H conflagrate Fluffy_Pillow 280066.2/1100000: 25% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:59.097 default Q chaos_bolt Fluffy_Pillow 296618.2/1100000: 27% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
5:00.659 default Q chaos_bolt Fluffy_Pillow 319523.1/1100000: 29% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51868 51868 33640
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3112080 3112080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 13.94% 13.94% 3577
Haste 30.79% 29.79% 11173
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14387 14277 0
Mastery 67.65% 67.65% 5819
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 905.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="BD/ELT/SH/Sac/CDF"
level=110
race=troll
role=spell
position=back
talents=1303032
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=904.60
# gear_stamina=33640
# gear_intellect=38456
# gear_crit_rating=3577
# gear_haste_rating=11173
# gear_mastery_rating=5819
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

BD/ELT/SH/Sac/SC : 808685 dps, 427529 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
808684.6 808684.6 724.6 / 0.090% 142855.4 / 17.7% 21.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
32205.9 32205.9 Mana 0.00% 59.2 100.0% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Sacrifice
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
BD/ELT/SH/Sac/SC 808685
Chaos Bolt 213824 26.5% 65.2 4.51sec 984864 920796 Direct 82.1 0 781987 781987 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.21 82.13 0.00 0.00 1.0696 0.0000 64226467.79 64226467.79 0.00 920796.37 920796.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 82.13 100.00% 781986.70 511950 1132774 782258.55 729973 836229 64226468 64226468 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 66498 8.2% 47.2 6.39sec 422684 417132 Direct 59.6 196281 441830 334840 56.4%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.22 59.61 0.00 0.00 1.0133 0.0000 19960160.56 19960160.56 0.00 417131.52 417131.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.98 43.57% 196280.96 129234 285988 196336.93 172335 221529 5098444 5098444 0.00
crit 33.64 56.43% 441830.29 258487 651723 441877.67 390178 497591 14861717 14861717 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 8130 1.0% 20.2 1.48sec 118481 0 Direct 20.0 105559 211291 120189 13.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.24 19.95 0.00 0.00 0.0000 0.0000 2397842.78 2397842.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.19 86.16% 105558.53 87244 115162 105557.92 97405 112763 1814537 1814537 0.00
crit 2.76 13.84% 211291.02 174488 230324 199293.93 0 230324 583306 583306 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Demonic Power 119125 14.7% 143.5 2.09sec 249105 0 Direct 451.1 69560 139124 79257 13.9%  

Stats details: demonic_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 143.52 451.09 0.00 0.00 0.0000 0.0000 35751350.29 35751350.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 388.21 86.06% 69560.05 61705 81451 69545.04 66883 72637 27003963 27003963 0.00
crit 62.87 13.94% 139123.77 123410 162902 139092.52 131638 148179 8747388 8747388 0.00
 
 

Action details: demonic_power

Static Values
  • id:196100
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196100
  • name:Demonic Power
  • school:shadow
  • tooltip:
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 220735 27.4% 105.8 2.82sec 626905 594775 Direct 114.6 134568 269062 196424 46.0%  
Periodic 411.6 72966 145885 106477 46.0% 274.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.83 114.64 411.59 411.59 1.0540 2.0065 66342448.79 66342448.79 0.00 70772.53 594775.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.91 54.01% 134568.43 89660 198414 134545.69 122818 144579 8331767 8331767 0.00
crit 52.72 45.99% 269062.14 179319 396826 269032.07 242848 291282 14186131 14186131 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 222.4 54.04% 72965.99 26 107473 72958.36 68950 76558 16230269 16230269 0.00
crit 189.2 45.96% 145885.10 98 214945 145878.36 138643 153672 27594282 27594282 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 26389 3.3% 26.6 10.88sec 297819 327012 Direct 30.6 227132 454140 258966 14.0%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.57 30.56 0.00 0.00 0.9108 0.0000 7914008.06 7914008.06 0.00 327011.61 327011.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.27 85.98% 227131.98 145375 320735 227373.21 197739 261324 5967807 5967807 0.00
crit 4.29 14.02% 454140.10 290465 641440 446946.12 0 640984 1946201 1946201 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9495 1.2% 20.2 14.90sec 141480 0 Direct 20.2 124189 248343 141483 13.9%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.16 20.16 0.00 0.00 0.0000 0.0000 2852075.71 2852075.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.35 86.07% 124188.90 109698 144802 124183.80 116554 135519 2154826 2154826 0.00
crit 2.81 13.93% 248343.27 219396 289603 234157.88 0 289603 697250 697250 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Rain of Fire 34136 4.2% 8.1 28.21sec 1262513 1286956 Periodic 191.5 46905 93811 53471 14.0% 0.0%

Stats details: rain_of_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.11 0.00 0.00 191.46 0.9811 0.0000 10237732.16 10237732.16 0.00 1286955.65 1286955.65
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 164.7 86.00% 46904.87 31659 70059 46821.42 0 55092 7723461 7723461 0.00
crit 26.8 14.00% 93811.20 63336 140119 93610.40 0 116025 2514272 2514272 0.00
 
 

Action details: rain_of_fire

Static Values
  • id:5740
  • school:fire
  • resource:soul_shard
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
Spelldata
  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.
 
pet - infernal 152153 / 25928
Immolation 132047 2.7% 2.1 180.61sec 3196707 0 Periodic 159.3 36595 73180 41705 14.0% 16.3%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 40.08 159.25 0.0000 1.2194 6641822.97 6641822.97 0.00 135885.74 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 137.0 86.03% 36595.47 34281 41137 36599.65 35891 37416 5013936 5013936 0.00
crit 22.2 13.97% 73180.00 68561 82274 73187.78 68561 79226 1627887 1627887 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 20106 0.4% 40.1 5.48sec 25239 20698 Direct 40.1 22161 44290 25239 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.08 40.08 0.00 0.00 1.2194 0.0000 1011667.02 1487246.35 31.98 20697.80 20697.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.51 86.09% 22161.12 20500 24600 22160.48 21558 22857 764712 1124198 31.98
crit 5.58 13.91% 44289.52 41000 49200 44175.99 0 49200 246955 363048 31.90
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 185939 / 15759
Immolation 161625 1.7% 1.0 0.00sec 4040791 0 Periodic 92.8 38238 76426 43553 13.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.83 92.78 0.0000 1.0787 4040791.18 4040791.18 0.00 164099.71 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.9 86.08% 38238.04 34281 41137 38247.65 37384 39448 3053855 3053855 0.00
crit 12.9 13.92% 76425.57 68561 82274 76437.95 68561 82274 986936 986936 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24314 0.3% 22.8 1.08sec 26629 24686 Direct 22.8 23380 46817 26629 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.83 22.83 0.00 0.00 1.0787 0.0000 607866.79 893621.76 31.98 24685.95 24685.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.66 86.14% 23379.60 20500 24600 23379.94 22687 24168 459701 675803 31.98
crit 3.16 13.86% 46816.64 41000 49200 45255.82 0 49200 148166 217818 30.91
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 186018 / 15765
Immolation 161682 1.7% 1.0 0.00sec 4042205 0 Periodic 92.8 38233 76489 43569 13.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.83 92.78 0.0000 1.0787 4042205.06 4042205.06 0.00 164157.13 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.8 86.05% 38232.94 34281 41137 38242.47 37301 39322 3052441 3052441 0.00
crit 12.9 13.95% 76488.58 68561 82274 76513.45 68561 82274 989764 989764 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24336 0.3% 22.8 1.08sec 26653 24708 Direct 22.8 23383 46770 26654 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.83 22.83 0.00 0.00 1.0787 0.0000 608421.58 894437.35 31.98 24708.48 24708.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.64 86.02% 23383.37 20500 24600 23384.05 22687 24359 459146 674988 31.98
crit 3.19 13.98% 46769.83 41000 49200 45309.40 0 49200 149276 219450 30.99
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 186001 / 15765
Immolation 161673 1.7% 1.0 0.00sec 4041981 0 Periodic 92.8 38235 76466 43566 13.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.83 92.78 0.0000 1.0787 4041980.84 4041980.84 0.00 164148.02 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.8 86.05% 38234.78 34281 41137 38244.58 37397 39371 3052665 3052665 0.00
crit 12.9 13.95% 76465.82 68561 82274 76486.09 68561 82274 989316 989316 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24328 0.3% 22.8 1.08sec 26645 24701 Direct 22.8 23383 46773 26646 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.83 22.83 0.00 0.00 1.0787 0.0000 608235.01 894163.08 31.98 24700.90 24700.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.64 86.05% 23383.11 20500 24600 23383.87 22806 24307 459332 675262 31.98
crit 3.18 13.95% 46772.97 41000 49200 45186.60 0 49200 148903 218901 30.89
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 116516 / 16194
Shadow Bolt 116516 2.0% 3.6 75.39sec 1360496 0 Periodic 39.3 108172 215922 123090 13.8% 16.1%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 39.27 39.27 0.0000 1.2350 4833356.45 4833356.45 0.00 99669.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.8 86.15% 108172.31 69 126576 107850.83 0 126576 3659477 3659477 0.00
crit 5.4 13.85% 215921.99 293 253152 209696.78 0 253152 1173880 1173880 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 141527 / 7403
Chaos Bolt 141527 0.9% 3.5 71.51sec 631417 306989 Direct 3.5 0 631422 631422 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.51 3.51 0.00 0.00 2.0570 0.0000 2215233.70 2215233.70 0.00 306989.15 306989.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.51 100.00% 631422.50 600929 721115 631325.84 0 721115 2215234 2215234 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 250856 / 14280
Chaos Barrage 250856 1.8% 3.6 77.31sec 1199651 0 Periodic 122.4 30625 61209 34877 13.9% 6.4%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 122.43 122.43 0.0000 0.1584 4270091.88 4270091.88 0.00 220175.92 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.4 86.10% 30624.64 152 34809 30516.87 27649 34809 3228187 3228187 0.00
crit 17.0 13.90% 61209.10 304 69619 60940.94 0 69619 1041905 1041905 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
BD/ELT/SH/Sac/SC
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:BD/ELT/SH/Sac/SC
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.49sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.09 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 10.4 33.09sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.44 0.00 0.00 0.00 0.9922 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:BD/ELT/SH/Sac/SC
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:BD/ELT/SH/Sac/SC
  • harmful:false
  • if_expr:
 
Grimoire of Sacrifice 1.0 0.00sec

Stats details: grimoire_of_sacrifice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_of_sacrifice

Static Values
  • id:108503
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_sacrifice.enabled
Spelldata
  • id:108503
  • name:Grimoire of Sacrifice
  • school:shadow
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.
 
Havoc 10.8 28.26sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.78 0.00 0.00 0.00 1.0338 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 14.6 21.09sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.56 0.00 0.00 0.00 0.9857 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 3.0 120.67sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 2.1 180.61sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 0.00 0.00 0.8616 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.48% 78.48% 1.7(1.7) 19.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.53%
  • accelerando_2:24.28%
  • accelerando_3:14.57%
  • accelerando_4:6.75%
  • accelerando_5:3.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Backdraft 47.2 0.0 6.4sec 6.4sec 70.14% 55.58% 0.0(0.0) 10.9

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:20.26%
  • backdraft_2:49.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 180.5sec 180.5sec 6.89% 6.26% 0.0(0.0) 2.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 12.45% 0.0(0.0) 1.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 23.7 0.0 12.6sec 12.6sec 53.94% 48.83% 0.0(0.0) 0.1

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:53.94%

Trigger Attempt Success

  • trigger_pct:50.17%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.6sec 69.6sec 8.72% 8.72% 0.0(0.0) 3.2

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 21.5 44.7 14.3sec 4.5sec 53.21% 71.56% 44.7(44.7) 20.9

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:53.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 7.2 7.4 41.2sec 21.1sec 92.13% 88.92% 46.8(46.8) 6.2

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:92.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 99.09% 51.30% 0.0(0.0) 0.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:99.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.0sec 69.1sec 13.57% 13.57% 0.0(0.0) 3.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.57%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.17% 10.17% 0.0(0.0) 1.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 1.5 0.0 86.1sec 86.1sec 0.36% 0.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:0.36%

Trigger Attempt Success

  • trigger_pct:79.15%
Soul Harvest 3.0 0.0 120.7sec 120.7sec 18.43% 18.43% 0.0(0.0) 2.7

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:18.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Demonic Power

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • demonic_power_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196099
  • name:Demonic Power
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.5 71.6sec
chaos_tear 3.5 72.4sec
chaos_portal 3.5 72.0sec
dimension_ripper 1.3 91.4sec
soul_conduit 31.8 10.4sec

Resources

Resource Usage Type Count Total Average RPE APR
BD/ELT/SH/Sac/SC
chaos_bolt Soul Shard 66.2 132.4 2.0 2.0 485003.1
havoc Mana 10.8 948513.8 88000.0 88001.5 0.0
immolate Mana 105.8 6984493.1 66000.0 66000.2 9.5
incinerate Mana 26.6 1753773.7 66000.0 65997.7 4.5
rain_of_fire Soul Shard 8.1 24.3 3.0 3.0 420871.1
summon_infernal Soul Shard 2.1 2.1 1.0 1.0 0.0
Resource Gains Type Count Total Average Overflow
life_tap Mana 14.56 4435966.12 (49.28%) 304623.41 369537.23 7.69%
immolate Soul Shard 90.14 72.39 (45.72%) 0.80 17.75 19.69%
conflagrate Soul Shard 47.22 44.32 (27.99%) 0.94 2.90 6.14%
mp5_regen Mana 635.31 4564760.28 (50.72%) 7185.11 101367.15 2.17%
soul_conduit Soul Shard 31.75 31.75 (20.06%) 1.00 0.00 0.00%
soulsnatcher Soul Shard 9.93 9.86 (6.22%) 0.99 0.08 0.76%
Resource RPS-Gain RPS-Loss
Health 0.00 15067.18
Mana 29924.93 32205.93
Soul Shard 0.53 0.53
Combat End Resource Mean Min Max
Mana 418543.72 12658.63 1100000.00
Soul Shard 2.47 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.7%

Statistics & Data Analysis

Fight Length
Sample Data BD/ELT/SH/Sac/SC Fight Length
Count 9999
Mean 300.78
Minimum 214.57
Maximum 375.75
Spread ( max - min ) 161.18
Range [ ( max - min ) / 2 * 100% ] 26.79%
DPS
Sample Data BD/ELT/SH/Sac/SC Damage Per Second
Count 9999
Mean 808684.58
Minimum 692859.02
Maximum 973311.59
Spread ( max - min ) 280452.57
Range [ ( max - min ) / 2 * 100% ] 17.34%
Standard Deviation 36968.2971
5th Percentile 752120.64
95th Percentile 873039.56
( 95th Percentile - 5th Percentile ) 120918.92
Mean Distribution
Standard Deviation 369.7015
95.00% Confidence Intervall ( 807959.98 - 809409.18 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8028
0.1 Scale Factor Error with Delta=300 11666554
0.05 Scale Factor Error with Delta=300 46666213
0.01 Scale Factor Error with Delta=300 1166655306
Priority Target DPS
Sample Data BD/ELT/SH/Sac/SC Priority Target Damage Per Second
Count 9999
Mean 427529.07
Minimum 375265.45
Maximum 496723.23
Spread ( max - min ) 121457.77
Range [ ( max - min ) / 2 * 100% ] 14.20%
Standard Deviation 16433.2659
5th Percentile 402169.28
95th Percentile 456208.45
( 95th Percentile - 5th Percentile ) 54039.17
Mean Distribution
Standard Deviation 164.3409
95.00% Confidence Intervall ( 427206.96 - 427851.17 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5676
0.1 Scale Factor Error with Delta=300 2305322
0.05 Scale Factor Error with Delta=300 9221285
0.01 Scale Factor Error with Delta=300 230532114
DPS(e)
Sample Data BD/ELT/SH/Sac/SC Damage Per Second (Effective)
Count 9999
Mean 808684.58
Minimum 692859.02
Maximum 973311.59
Spread ( max - min ) 280452.57
Range [ ( max - min ) / 2 * 100% ] 17.34%
Damage
Sample Data BD/ELT/SH/Sac/SC Damage
Count 9999
Mean 209682086.15
Minimum 141380456.81
Maximum 294333339.96
Spread ( max - min ) 152952883.15
Range [ ( max - min ) / 2 * 100% ] 36.47%
DTPS
Sample Data BD/ELT/SH/Sac/SC Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data BD/ELT/SH/Sac/SC Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data BD/ELT/SH/Sac/SC Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data BD/ELT/SH/Sac/SC Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data BD/ELT/SH/Sac/SC Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data BD/ELT/SH/Sac/SC Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BD/ELT/SH/Sac/SCTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data BD/ELT/SH/Sac/SC Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 10.78 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 12.43 immolate,if=remains<=tick_time
F 89.81 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
G 2.09 berserking
0.00 blood_fury
0.00 arcane_torrent
0.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
H 25.01 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
I 14.72 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 12.38 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
K 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
L 1.08 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
M 2.98 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
N 8.11 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
O 9.43 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
P 65.74 chaos_bolt
0.00 shadowburn
Q 7.49 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
R 4.86 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 26.84 incinerate
T 1.18 life_tap

Sample Sequence

012689ABDEGHKMOOPSQSPISCFSHPFRSHPFFFFFFFJPPPQPSIPRSCFIPSHOPPIFFFFFFJNECFFIOPPIPPIPRSQJPSFFFFFFFFFCHPPEHJOPFFSIPPIPFFFEFFFHJCFFPPHPMPHPEPHPSQPJOFFFFFFFFECFHPPIPJFFNSIPESHFFFFFFHNJCFFPEIGLOPPHPPIPPPQJFFFEFFFFFINCPSIPPQPSSJFEFQSPHPOFFFFFFHECFFJPIPPMQPSSHPRSSSFFFFFFFHFJCPPEHOPSFFHSSHPPHFFFJEFFFHCFFPP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask BD/ELT/SH/Sac/SC 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food BD/ELT/SH/Sac/SC 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation BD/ELT/SH/Sac/SC 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 8 grimoire_of_sacrifice Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
0:00.000 precombat 9 life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
0:00.000 precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 default D dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.102 default E immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.976 default G berserking Fluffy_Pillow 1034094.9/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.976 default H conflagrate Fluffy_Pillow 1034094.9/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.734 default K summon_infernal Fluffy_Pillow 1050642.9/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, backdraft(2), conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.495 default M soul_harvest Fluffy_Pillow 1067256.3/1100000: 97% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.495 default O dimensional_rift Fluffy_Pillow 1067256.3/1100000: 97% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:04.253 default O dimensional_rift Fluffy_Pillow 1083804.3/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
0:05.013 default P chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
0:06.073 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:06.828 default Q conflagrate Fluffy_Pillow 1036641.6/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:07.588 default S incinerate Fluffy_Pillow 1053233.2/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:08.343 default P chaos_bolt Fluffy_Pillow 1003715.6/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:09.096 default I conflagrate Fluffy_Pillow 1020192.8/1100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:09.851 default S incinerate Fluffy_Pillow 1036918.6/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:10.605 default C havoc Fluffy_Pillow_Beast1 987622.2/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:11.358 default F immolate Fluffy_Pillow_Beast1 916341.1/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:12.136 default S incinerate Fluffy_Pillow 867243.5/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:12.891 default H conflagrate Fluffy_Pillow 815364.8/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:13.779 default P chaos_bolt Fluffy_Pillow 831973.6/1100000: 76% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, potion_of_deadly_grace
0:15.016 default F immolate Fluffy_Pillow_Pack_Beast1 855110.0/1100000: 78% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:15.903 default R immolate Fluffy_Pillow 805700.1/1100000: 73% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:16.788 default S incinerate Fluffy_Pillow 756252.9/1100000: 69% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:17.542 default H conflagrate Fluffy_Pillow 704355.4/1100000: 64% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:18.428 default P chaos_bolt Fluffy_Pillow 720926.8/1100000: 66% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:19.182 default F immolate Fluffy_Pillow_Pack_Beast2 735029.4/1100000: 67% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:20.068 default F immolate Fluffy_Pillow_Pack_Beast3 685600.8/1100000: 62% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:20.953 default F immolate Fluffy_Pillow_Pack_Beast4 636153.5/1100000: 58% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:21.839 default F immolate Fluffy_Pillow_Pack_Beast5 586724.9/1100000: 53% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:22.727 default F immolate Fluffy_Pillow_Pack_Beast6 537348.0/1100000: 49% mana | 4.0/5: 80% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:23.603 default F immolate Fluffy_Pillow_Heavy_Spear1 487979.6/1100000: 44% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:24.462 default F immolate Fluffy_Pillow_Heavy_Spear2 438527.2/1100000: 40% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:25.321 default J life_tap Fluffy_Pillow 389074.8/1100000: 35% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:26.182 default P chaos_bolt Fluffy_Pillow 735661.0/1100000: 67% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:27.900 default P chaos_bolt Fluffy_Pillow 768756.2/1100000: 70% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:28.932 default P chaos_bolt Fluffy_Pillow 788763.2/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:29.950 default Q conflagrate Fluffy_Pillow 808658.7/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:30.799 default P chaos_bolt Fluffy_Pillow 825251.4/1100000: 75% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:31.553 default S incinerate Fluffy_Pillow 839987.3/1100000: 76% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:32.307 default I conflagrate Fluffy_Pillow 788723.3/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:33.154 default P chaos_bolt Fluffy_Pillow 805276.8/1100000: 73% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:33.901 default R immolate Fluffy_Pillow 819969.3/1100000: 75% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:34.740 default S incinerate Fluffy_Pillow 770529.9/1100000: 70% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:35.494 default C havoc Fluffy_Pillow_Heavy_Spear1 718632.5/1100000: 65% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:36.380 default F immolate Fluffy_Pillow_Heavy_Spear2 647203.9/1100000: 59% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:37.268 default I conflagrate Fluffy_Pillow 597812.7/1100000: 54% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:38.154 default P chaos_bolt Fluffy_Pillow 614384.1/1100000: 56% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames
0:39.391 default S incinerate Fluffy_Pillow 637520.5/1100000: 58% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
0:40.146 default H conflagrate Fluffy_Pillow 585641.8/1100000: 53% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:41.042 default O dimensional_rift Fluffy_Pillow 598532.9/1100000: 54% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
0:42.192 default P chaos_bolt Fluffy_Pillow 615078.4/1100000: 56% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
0:43.159 default P chaos_bolt Fluffy_Pillow 628991.1/1100000: 57% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:44.126 default I conflagrate Fluffy_Pillow 642903.7/1100000: 58% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:45.277 default F immolate Fluffy_Pillow_Pack_Beast1 659463.6/1100000: 60% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
0:46.429 default F immolate Fluffy_Pillow_Pack_Beast2 610039.2/1100000: 55% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:47.560 default F immolate Fluffy_Pillow_Pack_Beast3 560554.9/1100000: 51% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:48.692 default F immolate Fluffy_Pillow_Pack_Beast4 511085.8/1100000: 46% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
0:49.809 default F immolate Fluffy_Pillow_Pack_Beast5 461637.9/1100000: 42% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
0:50.927 default F immolate Fluffy_Pillow_Pack_Beast6 412204.7/1100000: 37% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
0:52.043 default J life_tap Fluffy_Pillow 362744.6/1100000: 33% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
0:53.145 default N rain_of_fire Fluffy_Pillow 709311.6/1100000: 64% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
0:54.247 default E immolate Fluffy_Pillow 725878.7/1100000: 66% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
0:55.349 default C havoc Fluffy_Pillow_Heavy_Spear2 676445.7/1100000: 61% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
0:56.596 default F immolate Fluffy_Pillow_Heavy_Spear2 607192.7/1100000: 55% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
0:57.696 default F immolate Fluffy_Pillow_Heavy_Spear1 557729.7/1100000: 51% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
0:58.813 default I conflagrate Fluffy_Pillow 508270.2/1100000: 46% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:59.964 default O dimensional_rift Fluffy_Pillow 524830.1/1100000: 48% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos
1:01.115 default P chaos_bolt Fluffy_Pillow 541390.0/1100000: 49% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos
1:02.723 default P chaos_bolt Fluffy_Pillow 564641.7/1100000: 51% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:03.676 default I conflagrate Fluffy_Pillow 578558.1/1100000: 53% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:04.811 default P chaos_bolt Fluffy_Pillow 595132.2/1100000: 54% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:05.762 default P chaos_bolt Fluffy_Pillow 609046.1/1100000: 55% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:06.700 default I conflagrate Fluffy_Pillow 622945.7/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:07.817 default P chaos_bolt Fluffy_Pillow 639497.7/1100000: 58% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:08.755 default R immolate Fluffy_Pillow 653397.3/1100000: 59% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:09.872 default S incinerate Fluffy_Pillow 603949.4/1100000: 55% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:10.811 default Q conflagrate Fluffy_Pillow 551863.8/1100000: 50% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:11.921 default J life_tap Fluffy_Pillow 568412.0/1100000: 52% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando(3)
1:13.022 default P chaos_bolt Fluffy_Pillow 914964.0/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(3)
1:14.564 default S incinerate Fluffy_Pillow 938005.8/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
1:15.532 default F immolate Fluffy_Pillow_Heavy_Spear1 885932.8/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:16.683 default F immolate Fluffy_Pillow_Pack_Beast1 836492.7/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:17.834 default F immolate Fluffy_Pillow_Pack_Beast2 787052.6/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:18.987 default F immolate Fluffy_Pillow_Pack_Beast3 737641.3/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
1:20.139 default F immolate Fluffy_Pillow_Pack_Beast4 688219.3/1100000: 63% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:21.273 default F immolate Fluffy_Pillow_Pack_Beast5 638778.7/1100000: 58% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:22.406 default F immolate Fluffy_Pillow_Pack_Beast6 589323.6/1100000: 54% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:23.540 default F immolate Fluffy_Pillow_Heavy_Spear2 539886.8/1100000: 49% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:24.657 default F immolate Fluffy_Pillow_Beast1 490438.8/1100000: 45% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:25.776 default C havoc Fluffy_Pillow_Beast1 441191.5/1100000: 40% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:26.876 default H conflagrate Fluffy_Pillow 369728.5/1100000: 34% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:27.978 default P chaos_bolt Fluffy_Pillow 386295.5/1100000: 35% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(3)
1:29.520 default P chaos_bolt Fluffy_Pillow 409477.4/1100000: 37% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(3)
1:30.444 default E immolate Fluffy_Pillow 423368.5/1100000: 38% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:31.546 default H conflagrate Fluffy_Pillow 373935.5/1100000: 34% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:32.669 default J life_tap Fluffy_Pillow 390464.8/1100000: 35% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
1:33.821 default O dimensional_rift Fluffy_Pillow 737039.1/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
1:34.971 default P chaos_bolt Fluffy_Pillow 753584.6/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos
1:36.579 default F immolate Fluffy_Pillow_Heavy_Spear2 776825.7/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:37.712 default F immolate Fluffy_Pillow_Heavy_Spear1 727371.5/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:38.830 default S incinerate Fluffy_Pillow 677938.4/1100000: 62% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:39.770 default I conflagrate Fluffy_Pillow 625867.6/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:40.887 default P chaos_bolt Fluffy_Pillow 642419.6/1100000: 58% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
1:42.449 default P chaos_bolt Fluffy_Pillow 665565.9/1100000: 61% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:43.389 default I conflagrate Fluffy_Pillow 679495.1/1100000: 62% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:44.505 default P chaos_bolt Fluffy_Pillow 696032.3/1100000: 63% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando(2)
1:45.443 default F immolate Fluffy_Pillow_Pack_Beast1 709932.8/1100000: 65% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(3)
1:46.547 default F immolate Fluffy_Pillow_Pack_Beast2 660531.4/1100000: 60% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(4)
1:47.633 default F immolate Fluffy_Pillow_Pack_Beast3 611167.4/1100000: 56% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(5)
1:48.749 default E immolate Fluffy_Pillow 561711.7/1100000: 51% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
1:49.900 default F immolate Fluffy_Pillow_Pack_Beast4 512271.6/1100000: 47% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft, lord_of_flames
1:51.051 default F immolate Fluffy_Pillow_Pack_Beast5 462831.5/1100000: 42% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
1:52.202 default F immolate Fluffy_Pillow_Pack_Beast6 413391.4/1100000: 38% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
1:53.353 default H conflagrate Fluffy_Pillow 363951.4/1100000: 33% mana | 5.0/5: 100% soul_shard lord_of_flames
1:54.504 default J life_tap Fluffy_Pillow 380511.3/1100000: 35% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames
1:55.652 default C havoc Fluffy_Pillow_Heavy_Spear1 727028.0/1100000: 66% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames
1:56.802 default F immolate Fluffy_Pillow_Heavy_Spear1 655573.5/1100000: 60% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames
1:57.953 default F immolate Fluffy_Pillow_Heavy_Spear2 606134.5/1100000: 55% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
1:59.089 default P chaos_bolt Fluffy_Pillow 556723.2/1100000: 51% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
2:00.675 default P chaos_bolt Fluffy_Pillow 579883.1/1100000: 53% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
2:01.628 default H conflagrate Fluffy_Pillow 593800.6/1100000: 54% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:02.742 default P chaos_bolt Fluffy_Pillow 610360.3/1100000: 55% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando(3)
2:03.667 default M soul_harvest Fluffy_Pillow 624266.4/1100000: 57% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(3)
2:03.667 default P chaos_bolt Fluffy_Pillow 624266.4/1100000: 57% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(3)
2:04.594 default H conflagrate Fluffy_Pillow 638202.6/1100000: 58% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
2:05.695 default P chaos_bolt Fluffy_Pillow 654754.6/1100000: 60% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando(3)
2:06.621 default E immolate Fluffy_Pillow 668675.8/1100000: 61% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(3)
2:07.723 default P chaos_bolt Fluffy_Pillow 619242.8/1100000: 56% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(3)
2:08.647 default H conflagrate Fluffy_Pillow 633133.9/1100000: 58% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
2:09.748 default P chaos_bolt Fluffy_Pillow 649685.9/1100000: 59% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:10.673 default S incinerate Fluffy_Pillow 663123.5/1100000: 60% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:11.642 default Q conflagrate Fluffy_Pillow 611066.2/1100000: 56% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:12.774 default P chaos_bolt Fluffy_Pillow 627596.5/1100000: 57% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando
2:13.727 default J life_tap Fluffy_Pillow 641514.0/1100000: 58% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(2)
2:14.844 default O dimensional_rift Fluffy_Pillow 988066.0/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(2)
2:16.119 default F immolate Fluffy_Pillow_Heavy_Spear2 1006959.4/1100000: 92% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(2)
2:17.239 default F immolate Fluffy_Pillow_Pack_Beast1 957619.4/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(3)
2:18.341 default F immolate Fluffy_Pillow_Pack_Beast2 908186.5/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, accelerando(3)
2:19.442 default F immolate Fluffy_Pillow_Pack_Beast3 858738.5/1100000: 78% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3)
2:20.542 default F immolate Fluffy_Pillow_Pack_Beast4 809275.5/1100000: 74% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3)
2:21.643 default F immolate Fluffy_Pillow_Pack_Beast5 759887.4/1100000: 69% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4)
2:22.730 default F immolate Fluffy_Pillow_Pack_Beast6 710464.4/1100000: 65% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(5)
2:23.810 default F immolate Fluffy_Pillow_Heavy_Spear1 660978.7/1100000: 60% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
2:24.962 default E immolate Fluffy_Pillow 611553.0/1100000: 56% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
2:26.111 default C havoc Fluffy_Pillow_Beast1 562084.1/1100000: 51% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
2:27.262 default F immolate Fluffy_Pillow_Beast1 490644.1/1100000: 45% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
2:28.411 default H conflagrate Fluffy_Pillow 441175.2/1100000: 40% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
2:29.562 default P chaos_bolt Fluffy_Pillow 457735.1/1100000: 42% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos
2:31.172 default P chaos_bolt Fluffy_Pillow 481001.8/1100000: 44% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:32.123 default I conflagrate Fluffy_Pillow 494889.6/1100000: 45% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:33.237 default P chaos_bolt Fluffy_Pillow 511456.8/1100000: 46% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:34.163 default J life_tap Fluffy_Pillow 525379.1/1100000: 48% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:35.249 default F immolate Fluffy_Pillow_Heavy_Spear1 871939.7/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:36.335 default F immolate Fluffy_Pillow_Heavy_Spear2 822500.4/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:37.422 default N rain_of_fire Fluffy_Pillow 773076.3/1100000: 70% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:38.507 default S incinerate Fluffy_Pillow 789621.7/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(4)
2:39.421 default I conflagrate Fluffy_Pillow 737559.5/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
2:40.510 default P chaos_bolt Fluffy_Pillow 754165.9/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(4)
2:42.028 default E immolate Fluffy_Pillow 777390.4/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(5)
2:43.126 default S incinerate Fluffy_Pillow 727905.2/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
2:44.096 default H conflagrate Fluffy_Pillow 675861.0/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:45.247 default F immolate Fluffy_Pillow_Pack_Beast1 692420.9/1100000: 63% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos
2:46.398 default F immolate Fluffy_Pillow_Pack_Beast2 642980.8/1100000: 58% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames
2:47.549 default F immolate Fluffy_Pillow_Pack_Beast3 593570.9/1100000: 54% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
2:48.683 default F immolate Fluffy_Pillow_Pack_Beast4 544130.3/1100000: 49% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
2:49.815 default F immolate Fluffy_Pillow_Pack_Beast5 494685.0/1100000: 45% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(2)
2:50.934 default F immolate Fluffy_Pillow_Pack_Beast6 445266.7/1100000: 40% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(2)
2:52.051 default H conflagrate Fluffy_Pillow 395818.7/1100000: 36% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:53.169 default N rain_of_fire Fluffy_Pillow 412385.6/1100000: 37% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
2:54.288 default J life_tap Fluffy_Pillow 428967.3/1100000: 39% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
2:55.406 default C havoc Fluffy_Pillow_Heavy_Spear1 775534.2/1100000: 71% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
2:56.524 default F immolate Fluffy_Pillow_Heavy_Spear1 704101.1/1100000: 64% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
2:57.641 default F immolate Fluffy_Pillow_Heavy_Spear2 654653.2/1100000: 60% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
2:58.757 default P chaos_bolt Fluffy_Pillow 605190.4/1100000: 55% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
3:00.319 default E immolate Fluffy_Pillow 627944.5/1100000: 57% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:01.468 default I conflagrate Fluffy_Pillow 578580.7/1100000: 53% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:02.599 default G berserking Fluffy_Pillow 595096.4/1100000: 54% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando
3:02.599 default L summon_infernal Fluffy_Pillow 595096.4/1100000: 54% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando
3:03.720 default O dimensional_rift Fluffy_Pillow 613921.5/1100000: 56% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando
3:04.706 default P chaos_bolt Fluffy_Pillow 630479.5/1100000: 57% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, accelerando
3:06.087 default P chaos_bolt Fluffy_Pillow 653672.3/1100000: 59% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(2)
3:06.903 default H conflagrate Fluffy_Pillow 667577.8/1100000: 61% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:07.864 default P chaos_bolt Fluffy_Pillow 684117.9/1100000: 62% mana | 4.0/5: 80% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:08.668 default P chaos_bolt Fluffy_Pillow 698018.0/1100000: 63% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:09.474 default I conflagrate Fluffy_Pillow 711952.7/1100000: 65% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:10.434 default P chaos_bolt Fluffy_Pillow 728549.8/1100000: 66% mana | 4.0/5: 80% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:11.239 default P chaos_bolt Fluffy_Pillow 742467.2/1100000: 67% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:12.045 default P chaos_bolt Fluffy_Pillow 756401.9/1100000: 69% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:13.193 default Q conflagrate Fluffy_Pillow 774773.0/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:14.326 default J life_tap Fluffy_Pillow 791317.9/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:15.460 default F immolate Fluffy_Pillow_Heavy_Spear2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:16.594 default F immolate Fluffy_Pillow_Pack_Beast1 1034074.1/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:17.711 default F immolate Fluffy_Pillow_Pack_Beast2 984626.2/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
3:18.827 default E immolate Fluffy_Pillow 935163.4/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
3:19.945 default F immolate Fluffy_Pillow_Pack_Beast3 885730.3/1100000: 81% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:20.699 default F immolate Fluffy_Pillow_Pack_Beast4 830903.3/1100000: 76% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:21.454 default F immolate Fluffy_Pillow_Pack_Beast5 776091.1/1100000: 71% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:22.208 default F immolate Fluffy_Pillow_Pack_Beast6 721279.0/1100000: 66% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:22.963 default F immolate Fluffy_Pillow_Heavy_Spear1 666629.4/1100000: 61% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:23.718 default I conflagrate Fluffy_Pillow 611979.8/1100000: 56% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:24.473 default N rain_of_fire Fluffy_Pillow 623330.2/1100000: 57% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:25.227 default C havoc Fluffy_Pillow_Heavy_Spear2 634641.0/1100000: 58% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact
3:25.985 default P chaos_bolt Fluffy_Pillow 557546.6/1100000: 51% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact
3:27.044 default S incinerate Fluffy_Pillow 572782.9/1100000: 52% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:27.798 default I conflagrate Fluffy_Pillow 517631.0/1100000: 47% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:28.555 default P chaos_bolt Fluffy_Pillow 528522.3/1100000: 48% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:29.311 default P chaos_bolt Fluffy_Pillow 539399.2/1100000: 49% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:30.064 default Q conflagrate Fluffy_Pillow 550232.9/1100000: 50% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:30.820 default P chaos_bolt Fluffy_Pillow 561109.8/1100000: 51% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:31.574 default S incinerate Fluffy_Pillow 571957.9/1100000: 52% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:32.327 default S incinerate Fluffy_Pillow 516817.6/1100000: 47% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:33.929 default J life_tap Fluffy_Pillow 474212.3/1100000: 43% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:35.246 default F immolate Fluffy_Pillow_Heavy_Spear1 823728.0/1100000: 75% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:36.565 default E immolate Fluffy_Pillow 777274.9/1100000: 71% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
3:37.862 default F immolate Fluffy_Pillow_Heavy_Spear2 730900.7/1100000: 66% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
3:39.140 default Q conflagrate Fluffy_Pillow 684390.1/1100000: 62% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
3:40.401 default S incinerate Fluffy_Pillow 703890.8/1100000: 64% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(5)
3:41.302 default P chaos_bolt Fluffy_Pillow 651824.4/1100000: 59% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, accelerando(5)
3:42.797 default H conflagrate Fluffy_Pillow 674943.9/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
3:43.867 default P chaos_bolt Fluffy_Pillow 691490.9/1100000: 63% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando(5)
3:44.765 default O dimensional_rift Fluffy_Pillow 704776.0/1100000: 64% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
3:46.151 default F immolate Fluffy_Pillow_Pack_Beast1 724716.9/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
3:47.302 default F immolate Fluffy_Pillow_Pack_Beast2 675295.3/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
3:48.436 default F immolate Fluffy_Pillow_Pack_Beast3 625854.8/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
3:49.570 default F immolate Fluffy_Pillow_Pack_Beast4 576414.3/1100000: 52% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, accelerando
3:50.705 default F immolate Fluffy_Pillow_Pack_Beast6 526991.6/1100000: 48% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:51.822 default F immolate Fluffy_Pillow_Pack_Beast5 477555.3/1100000: 43% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:52.922 default H conflagrate Fluffy_Pillow 428092.3/1100000: 39% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:54.024 default E immolate Fluffy_Pillow 444659.4/1100000: 40% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(3)
3:55.125 default C havoc Fluffy_Pillow_Heavy_Spear2 395211.4/1100000: 36% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(3)
3:56.228 default F immolate Fluffy_Pillow_Heavy_Spear2 323793.5/1100000: 29% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(3)
3:57.328 default F immolate Fluffy_Pillow_Heavy_Spear1 274331.1/1100000: 25% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(4)
3:58.414 default J life_tap Fluffy_Pillow 224915.7/1100000: 20% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(5)
3:59.504 default P chaos_bolt Fluffy_Pillow 571461.8/1100000: 52% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos
4:01.115 default I conflagrate Fluffy_Pillow 595123.1/1100000: 54% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:02.233 default P chaos_bolt Fluffy_Pillow 611689.9/1100000: 56% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:03.171 default P chaos_bolt Fluffy_Pillow 625589.5/1100000: 57% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:04.109 default M soul_harvest Fluffy_Pillow 639504.2/1100000: 58% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:04.109 default Q conflagrate Fluffy_Pillow 639504.2/1100000: 58% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:05.212 default P chaos_bolt Fluffy_Pillow 656086.3/1100000: 60% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando(3)
4:06.139 default S incinerate Fluffy_Pillow 670022.4/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(3)
4:07.062 default S incinerate Fluffy_Pillow 617898.5/1100000: 56% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:08.384 default H conflagrate Fluffy_Pillow 571774.0/1100000: 52% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4)
4:09.476 default P chaos_bolt Fluffy_Pillow 588426.2/1100000: 53% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando(4)
4:10.389 default R immolate Fluffy_Pillow 602348.7/1100000: 55% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(4)
4:11.476 default S incinerate Fluffy_Pillow 552925.7/1100000: 50% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(5)
4:12.378 default S incinerate Fluffy_Pillow 499950.5/1100000: 45% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos
4:13.759 default S incinerate Fluffy_Pillow 453845.4/1100000: 41% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:15.118 default F immolate Fluffy_Pillow_Heavy_Spear1 407690.5/1100000: 37% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando
4:16.250 default F immolate Fluffy_Pillow_Pack_Beast1 358220.8/1100000: 33% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando
4:17.383 default F immolate Fluffy_Pillow_Pack_Beast2 308765.6/1100000: 28% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando
4:18.515 default F immolate Fluffy_Pillow_Pack_Beast3 259295.9/1100000: 24% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando
4:19.648 default F immolate Fluffy_Pillow_Pack_Beast4 209840.8/1100000: 19% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando
4:20.782 default F immolate Fluffy_Pillow_Pack_Beast5 160471.9/1100000: 15% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, accelerando(2)
4:21.902 default F immolate Fluffy_Pillow_Pack_Beast6 111068.4/1100000: 10% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando(2)
4:23.018 default H conflagrate Fluffy_Pillow 61605.6/1100000: 6% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, accelerando(2)
4:24.133 default F immolate Fluffy_Pillow_Heavy_Spear2 78128.1/1100000: 7% mana | 3.0/5: 60% soul_shard soul_harvest, backdraft(2), lord_of_flames, accelerando(2)
4:25.250 default J life_tap Fluffy_Pillow 28680.1/1100000: 3% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, accelerando(2)
4:26.389 default C havoc Fluffy_Pillow_Heavy_Spear2 375235.0/1100000: 34% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames
4:27.525 default P chaos_bolt Fluffy_Pillow 303823.7/1100000: 28% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
4:29.110 default P chaos_bolt Fluffy_Pillow 326969.0/1100000: 30% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
4:30.064 default E immolate Fluffy_Pillow 340900.0/1100000: 31% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:31.197 default H conflagrate Fluffy_Pillow 291444.9/1100000: 26% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:32.330 default O dimensional_rift Fluffy_Pillow 307989.8/1100000: 28% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando
4:33.464 default P chaos_bolt Fluffy_Pillow 324549.3/1100000: 30% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando
4:34.418 default S incinerate Fluffy_Pillow 338583.7/1100000: 31% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(2)
4:35.357 default F immolate Fluffy_Pillow_Heavy_Spear2 286498.1/1100000: 26% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:36.473 default F immolate Fluffy_Pillow_Heavy_Spear1 237036.0/1100000: 22% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:37.577 default H conflagrate Fluffy_Pillow 187634.7/1100000: 17% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
4:38.676 default S incinerate Fluffy_Pillow 204200.7/1100000: 19% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
4:39.630 default S incinerate Fluffy_Pillow 152133.0/1100000: 14% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, accelerando(2)
4:40.570 default H conflagrate Fluffy_Pillow 100062.2/1100000: 9% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:41.687 default P chaos_bolt Fluffy_Pillow 116614.3/1100000: 11% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(2)
4:43.250 default P chaos_bolt Fluffy_Pillow 140046.4/1100000: 13% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(3)
4:44.176 default H conflagrate Fluffy_Pillow 153968.6/1100000: 14% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
4:45.262 default F immolate Fluffy_Pillow_Pack_Beast1 170529.3/1100000: 16% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando(4)
4:46.349 default F immolate Fluffy_Pillow_Pack_Beast2 121106.2/1100000: 11% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando(5)
4:47.419 default F immolate Fluffy_Pillow_Pack_Beast3 71653.3/1100000: 7% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando(5)
4:48.490 default J life_tap Fluffy_Pillow 22215.8/1100000: 2% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, accelerando(5)
4:49.560 default E immolate Fluffy_Pillow 368762.9/1100000: 34% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(5)
4:50.647 default F immolate Fluffy_Pillow_Pack_Beast6 319331.5/1100000: 29% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames
4:51.798 default F immolate Fluffy_Pillow_Pack_Beast5 269891.4/1100000: 25% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
4:52.950 default F immolate Fluffy_Pillow_Pack_Beast4 220465.7/1100000: 20% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
4:54.104 default H conflagrate Fluffy_Pillow 171068.8/1100000: 16% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
4:55.253 default C havoc Fluffy_Pillow_Heavy_Spear2 187600.0/1100000: 17% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos
4:56.405 default F immolate Fluffy_Pillow_Heavy_Spear2 116174.3/1100000: 11% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos
4:57.556 default F immolate Fluffy_Pillow_Heavy_Spear1 66745.1/1100000: 6% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
4:58.688 default P chaos_bolt Fluffy_Pillow 17275.4/1100000: 2% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
5:00.272 default P chaos_bolt Fluffy_Pillow 40406.1/1100000: 4% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51868 51868 33640
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3112080 3112080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 13.94% 13.94% 3577
Haste 30.79% 29.79% 11173
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14387 14277 0
Mastery 67.65% 67.65% 5819
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 905.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="BD/ELT/SH/Sac/SC"
level=110
race=troll
role=spell
position=back
talents=1303033
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=904.60
# gear_stamina=33640
# gear_intellect=38456
# gear_crit_rating=3577
# gear_haste_rating=11173
# gear_mastery_rating=5819
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

BD/ELT/SH/Sac/WH : 799861 dps, 398556 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
799861.2 799861.2 768.7 / 0.096% 152953.4 / 19.1% 18.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
36475.5 36475.5 Mana 0.00% 58.8 100.0% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Sacrifice
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
BD/ELT/SH/Sac/WH 799861
Chaos Bolt 200060 25.1% 48.0 6.14sec 1251604 1073033 Direct 76.9 0 780555 780555 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.97 76.92 0.00 0.00 1.1664 0.0000 60043682.40 60043682.40 0.00 1073032.55 1073032.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 76.92 100.00% 780555.45 511892 1132772 780787.24 728401 843210 60043682 60043682 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 85976 10.8% 48.1 6.27sec 535896 524612 Direct 77.0 196854 442680 335120 56.2%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.14 76.99 0.00 0.00 1.0215 0.0000 25799897.67 25799897.67 0.00 524612.08 524612.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.68 43.75% 196854.11 129246 285987 196899.43 176928 224093 6630987 6630987 0.00
crit 43.30 56.25% 442679.77 258828 651726 442709.21 398810 495383 19168911 19168911 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 8160 1.0% 20.1 1.49sec 119541 0 Direct 19.8 106720 213331 121519 13.9%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.14 19.81 0.00 0.00 0.0000 0.0000 2407429.23 2407429.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.06 86.12% 106720.42 87244 115162 106710.54 96371 112603 1820896 1820896 0.00
crit 2.75 13.88% 213330.57 174488 230324 201078.98 0 230324 586534 586534 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Demonic Power 107989 13.5% 142.0 2.11sec 228171 0 Direct 402.2 70694 141370 80550 13.9%  

Stats details: demonic_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.99 402.22 0.00 0.00 0.0000 0.0000 32398993.28 32398993.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 346.13 86.06% 70694.06 61705 81451 70687.03 68028 73383 24469639 24469639 0.00
crit 56.09 13.94% 141370.37 123410 162902 141359.45 134484 149957 7929355 7929355 0.00
 
 

Action details: demonic_power

Static Values
  • id:196100
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196100
  • name:Demonic Power
  • school:shadow
  • tooltip:
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 163273 20.5% 65.1 4.57sec 754192 717028 Direct 84.0 136854 273806 199886 46.0%  
Periodic 299.9 73792 147625 107665 45.9% 198.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.08 84.05 299.86 299.86 1.0518 1.9933 49084129.80 49084129.80 0.00 73680.76 717027.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.37 53.98% 136853.62 89660 198414 136866.08 124523 150196 6208574 6208574 0.00
crit 38.68 46.02% 273805.92 179321 396829 273836.48 244413 302653 10591457 10591457 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 162.3 54.12% 73791.63 26 107472 73794.51 69556 77848 11975712 11975712 0.00
crit 137.6 45.88% 147625.27 61 214945 147631.08 137691 156684 20308388 20308388 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 63267 7.9% 50.3 5.86sec 377567 401229 Direct 74.4 224077 448543 255399 14.0%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.30 74.35 0.00 0.00 0.9410 0.0000 18989765.87 18989765.87 0.00 401228.97 401228.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.98 86.05% 224076.56 145328 320737 224215.07 207357 244714 14335861 14335861 0.00
crit 10.38 13.95% 448542.52 294363 641447 448933.46 0 601834 4653904 4653904 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9541 1.2% 20.1 14.89sec 142327 0 Direct 20.1 124843 249747 142324 14.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.13 20.13 0.00 0.00 0.0000 0.0000 2865191.00 2865191.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.31 86.00% 124843.47 109698 144802 124832.49 117293 136757 2161459 2161459 0.00
crit 2.82 14.00% 249746.65 219396 289603 235033.75 0 289603 703732 703732 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Rain of Fire 47119 5.9% 6.1 42.00sec 2331437 2266779 Periodic 259.6 47860 95653 54529 14.0% 0.0%

Stats details: rain_of_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.07 0.00 0.00 259.61 1.0286 0.0000 14156034.64 14156034.64 0.00 2266778.97 2266778.97
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.4 86.05% 47860.32 31681 70059 47779.72 0 59253 10691333 10691333 0.00
crit 36.2 13.95% 95653.50 63362 140119 95470.81 0 123544 3464701 3464701 0.00
 
 

Action details: rain_of_fire

Static Values
  • id:5740
  • school:fire
  • resource:soul_shard
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
Spelldata
  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.
 
pet - infernal 152138 / 25905
Immolation 132032 2.8% 2.1 181.02sec 3201290 0 Periodic 159.2 36593 73195 41680 13.9% 16.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 40.04 159.19 0.0000 1.2199 6635016.20 6635016.20 0.00 135846.53 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 137.1 86.10% 36593.15 34281 41137 36597.45 35934 38246 5015688 5015688 0.00
crit 22.1 13.90% 73195.09 68561 82274 73201.42 68561 81219 1619329 1619329 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 20106 0.4% 40.0 5.46sec 25242 20693 Direct 40.0 22162 44291 25242 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.04 40.04 0.00 0.00 1.2199 0.0000 1010689.08 1485808.68 31.98 20693.03 20693.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.47 86.08% 22162.15 20500 24600 22161.83 21604 23575 763843 1122922 31.98
crit 5.57 13.92% 44290.93 41000 49200 44133.38 0 49200 246846 362886 31.87
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 85068 / 8847
Doom Bolt 85068 0.9% 11.0 2.15sec 193344 88764 Direct 11.0 181003 362007 193344 6.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.00 11.00 0.00 0.00 2.1782 0.0000 2126788.38 2126788.38 0.00 88764.12 88764.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.25 93.18% 181003.27 181003 181003 181003.27 181003 181003 1855283 1855283 0.00
crit 0.75 6.82% 362006.53 362007 362007 271504.90 0 362007 271505 271505 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 186019 / 15766
Immolation 161705 1.7% 1.0 0.00sec 4042797 0 Periodic 92.8 38233 76449 43567 14.0% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.83 92.80 0.0000 1.0787 4042797.49 4042797.49 0.00 164187.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.8 86.04% 38232.57 34281 41137 38242.17 37337 39423 3052653 3052653 0.00
crit 13.0 13.96% 76448.53 68561 82274 76464.31 68561 82274 990144 990144 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24313 0.3% 22.8 1.08sec 26628 24687 Direct 22.8 23381 46797 26628 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.83 22.83 0.00 0.00 1.0787 0.0000 607859.82 893611.52 31.98 24686.67 24686.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.66 86.13% 23380.98 20500 24600 23381.28 22550 24344 459717 675828 31.98
crit 3.17 13.87% 46797.10 41000 49200 45329.95 0 49200 148142 217783 30.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 185992 / 15764
Immolation 161647 1.7% 1.0 0.00sec 4041336 0 Periodic 92.8 38231 76465 43550 13.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.83 92.80 0.0000 1.0787 4041336.30 4041336.30 0.00 164128.51 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.9 86.09% 38231.20 34281 41137 38240.54 37354 39276 3054115 3054115 0.00
crit 12.9 13.91% 76465.43 68561 82274 76488.24 68561 82274 987222 987222 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24345 0.3% 22.8 1.08sec 26662 24718 Direct 22.8 23381 46799 26663 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.83 22.83 0.00 0.00 1.0787 0.0000 608639.31 894757.43 31.98 24718.32 24718.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.63 85.99% 23380.81 20500 24600 23381.20 22687 24344 458938 674682 31.98
crit 3.20 14.01% 46798.80 41000 49200 45363.21 0 49200 149701 220075 30.99
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 185989 / 15764
Immolation 161643 1.7% 1.0 0.00sec 4041233 0 Periodic 92.8 38231 76467 43549 13.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.83 92.80 0.0000 1.0787 4041233.45 4041233.45 0.00 164124.33 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.9 86.09% 38231.06 34281 41137 38240.38 37384 39374 3054218 3054218 0.00
crit 12.9 13.91% 76467.19 68561 82274 76489.09 68561 82274 987016 987016 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24346 0.3% 22.8 1.08sec 26664 24720 Direct 22.8 23384 46760 26664 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.83 22.83 0.00 0.00 1.0787 0.0000 608677.44 894813.49 31.98 24719.87 24719.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.62 85.97% 23384.00 20500 24600 23384.96 22687 24327 458900 674626 31.98
crit 3.20 14.03% 46759.69 41000 49200 45383.05 0 49200 149778 220187 31.03
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 114676 / 17653
Shadow Bolt 114676 2.2% 3.9 68.78sec 1343968 0 Periodic 43.1 107388 214737 122406 14.0% 17.8%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.92 0.00 43.06 43.06 0.0000 1.2461 5270815.29 5270815.29 0.00 98229.81 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.0 86.01% 107387.81 83 126576 107126.46 0 126576 3977157 3977157 0.00
crit 6.0 13.99% 214736.85 142 253152 209839.34 0 253152 1293658 1293658 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 141778 / 8345
Chaos Bolt 141778 1.0% 3.9 65.78sec 634672 305255 Direct 3.9 0 634667 634667 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 3.94 0.00 0.00 2.0792 0.0000 2498816.54 2498816.54 0.00 305254.89 305254.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.94 100.00% 634667.03 600929 721115 634924.60 0 721115 2498817 2498817 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 246566 / 15739
Chaos Barrage 246566 2.0% 3.9 69.23sec 1191916 0 Periodic 134.4 30696 61395 34972 13.9% 7.2%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 0.00 134.36 134.36 0.0000 0.1601 4698778.77 4698778.77 0.00 218385.33 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 115.6 86.07% 30696.44 152 34809 30614.49 27696 34809 3549995 3549995 0.00
crit 18.7 13.93% 61394.73 304 69619 61202.80 0 69619 1148783 1148783 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
BD/ELT/SH/Sac/WH
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:BD/ELT/SH/Sac/WH
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.68sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.09 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 11.7 28.73sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.69 0.00 0.00 0.00 1.0076 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:BD/ELT/SH/Sac/WH
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:BD/ELT/SH/Sac/WH
  • harmful:false
  • if_expr:
 
Grimoire of Sacrifice 1.0 0.00sec

Stats details: grimoire_of_sacrifice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_of_sacrifice

Static Values
  • id:108503
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_sacrifice.enabled
Spelldata
  • id:108503
  • name:Grimoire of Sacrifice
  • school:shadow
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.
 
Havoc 38.1 7.55sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.14 0.00 0.00 0.00 1.0333 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 17.7 17.21sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.75 0.00 0.00 0.00 0.9781 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 3.0 120.55sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 2.1 181.02sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.8585 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.52% 78.52% 1.6(1.6) 19.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.68%
  • accelerando_2:24.37%
  • accelerando_3:14.62%
  • accelerando_4:6.66%
  • accelerando_5:3.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Backdraft 48.1 0.0 6.3sec 6.3sec 73.55% 56.72% 0.0(0.0) 10.4

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:24.30%
  • backdraft_2:49.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.88% 6.48% 0.0(0.0) 2.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 12.97% 0.0(0.0) 1.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.1 0.0 12.3sec 12.3sec 51.53% 48.86% 0.0(0.0) 0.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:51.53%

Trigger Attempt Success

  • trigger_pct:50.03%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.8sec 69.8sec 8.71% 8.71% 0.0(0.0) 3.2

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.71%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 25.9 23.1 11.8sec 6.1sec 49.79% 59.19% 23.1(23.1) 25.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:49.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 3.8 14.0 49.6sec 17.2sec 97.67% 96.17% 51.3(51.3) 2.8

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:97.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 99.09% 51.24% 0.0(0.0) 0.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:99.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.2sec 69.4sec 13.56% 13.56% 0.0(0.0) 3.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.17% 10.17% 0.0(0.0) 1.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 1.5 0.0 85.5sec 85.5sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.48%
Soul Harvest 3.0 0.0 120.6sec 120.6sec 18.42% 18.42% 0.0(0.0) 2.7

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:18.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Demonic Power

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • demonic_power_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196099
  • name:Demonic Power
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.9 66.6sec
chaos_tear 3.9 66.1sec
chaos_portal 3.9 66.2sec
dimension_ripper 2.5 73.4sec

Resources

Resource Usage Type Count Total Average RPE APR
BD/ELT/SH/Sac/WH
chaos_bolt Soul Shard 49.0 97.9 2.0 2.0 613017.1
havoc Mana 38.1 3356228.3 88000.0 88002.4 0.0
immolate Mana 65.1 4295410.4 66000.0 66000.3 11.4
incinerate Mana 50.3 3319325.6 66000.0 65997.1 5.7
rain_of_fire Soul Shard 6.1 18.2 3.0 3.0 777136.5
summon_doomguard Soul Shard 0.0 0.0 1.0 1.0 0.0
summon_infernal Soul Shard 2.1 2.1 1.0 1.0 0.0
pet - doomguard
doom_bolt Energy 0.0 0.2 35.0 0.0 13814457.3
Resource Gains Type Count Total Average Overflow
life_tap Mana 17.75 5510122.37 (54.58%) 310459.59 346808.55 5.92%
immolate Soul Shard 65.63 61.96 (53.07%) 0.94 3.67 5.59%
conflagrate Soul Shard 48.14 47.46 (40.65%) 0.99 0.68 1.42%
mp5_regen Mana 575.85 4585671.04 (45.42%) 7963.32 79755.19 1.71%
soulsnatcher Soul Shard 7.33 7.33 (6.28%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 0.00 0.14 (100.00%) 31.78 0.02 10.88%
Resource RPS-Gain RPS-Loss
Health 0.00 18363.90
Mana 33565.93 36475.54
Soul Shard 0.39 0.39
Combat End Resource Mean Min Max
Mana 222968.69 7909.82 763972.84
Soul Shard 1.52 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.3%

Statistics & Data Analysis

Fight Length
Sample Data BD/ELT/SH/Sac/WH Fight Length
Count 9999
Mean 300.78
Minimum 214.57
Maximum 375.75
Spread ( max - min ) 161.18
Range [ ( max - min ) / 2 * 100% ] 26.79%
DPS
Sample Data BD/ELT/SH/Sac/WH Damage Per Second
Count 9999
Mean 799861.18
Minimum 680908.77
Maximum 947592.51
Spread ( max - min ) 266683.73
Range [ ( max - min ) / 2 * 100% ] 16.67%
Standard Deviation 39216.9694
5th Percentile 738287.98
95th Percentile 866412.10
( 95th Percentile - 5th Percentile ) 128124.12
Mean Distribution
Standard Deviation 392.1893
95.00% Confidence Intervall ( 799092.51 - 800629.86 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9235
0.1 Scale Factor Error with Delta=300 13129003
0.05 Scale Factor Error with Delta=300 52516010
0.01 Scale Factor Error with Delta=300 1312900238
Priority Target DPS
Sample Data BD/ELT/SH/Sac/WH Priority Target Damage Per Second
Count 9999
Mean 398555.89
Minimum 345267.01
Maximum 466601.27
Spread ( max - min ) 121334.26
Range [ ( max - min ) / 2 * 100% ] 15.22%
Standard Deviation 16951.5641
5th Percentile 372076.95
95th Percentile 427454.31
( 95th Percentile - 5th Percentile ) 55377.35
Mean Distribution
Standard Deviation 169.5241
95.00% Confidence Intervall ( 398223.63 - 398888.15 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6950
0.1 Scale Factor Error with Delta=300 2453033
0.05 Scale Factor Error with Delta=300 9812129
0.01 Scale Factor Error with Delta=300 245303205
DPS(e)
Sample Data BD/ELT/SH/Sac/WH Damage Per Second (Effective)
Count 9999
Mean 799861.18
Minimum 680908.77
Maximum 947592.51
Spread ( max - min ) 266683.73
Range [ ( max - min ) / 2 * 100% ] 16.67%
Damage
Sample Data BD/ELT/SH/Sac/WH Damage
Count 9999
Mean 205745123.89
Minimum 141374225.21
Maximum 289973069.33
Spread ( max - min ) 148598844.12
Range [ ( max - min ) / 2 * 100% ] 36.11%
DTPS
Sample Data BD/ELT/SH/Sac/WH Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data BD/ELT/SH/Sac/WH Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data BD/ELT/SH/Sac/WH Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data BD/ELT/SH/Sac/WH Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data BD/ELT/SH/Sac/WH Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data BD/ELT/SH/Sac/WH Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BD/ELT/SH/Sac/WHTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data BD/ELT/SH/Sac/WH Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 38.14 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.32 immolate,if=remains<=tick_time
F 50.65 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
G 2.09 berserking
0.00 blood_fury
0.00 arcane_torrent
0.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
H 24.81 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
I 11.80 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 5.84 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
K 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
L 0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
M 1.07 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
N 2.98 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
O 6.07 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 10.69 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 48.46 chaos_bolt
0.00 shadowburn
R 11.54 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
S 6.49 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
T 50.93 incinerate
U 10.91 life_tap

Sample Sequence

012689ABDEGHKNPPTTHQQITCFTIQSFTIOTJTHQTHFCCCCCCCQIQQCEFIQJTHQTHOPQQFFFEFCFFIJQTIQTHQSTHTTRFFFFFFFFFJOQCISTQHPTTHFCCQFUCCCCQFIUQETQITQCFFITTRNQSUTHQTTUQFFFFFFFFECFHPQQHQTFIQJQHCCCEQTHTPTUTCFFIPQEGMQITQIQTRQTTRFFFFFJEFFCHQQHQTTHCCCUCCCCEIPFOUTTHTCFFSQIQNQRQTPRQTTUTTFFFFHOUFEFFFOCIQPQHQCCUCCCCCIQEUFTIQUQCFFIQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask BD/ELT/SH/Sac/WH 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food BD/ELT/SH/Sac/WH 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation BD/ELT/SH/Sac/WH 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 8 grimoire_of_sacrifice Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
0:00.000 precombat 9 life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
0:00.000 precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 default D dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.102 default E immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.976 default G berserking Fluffy_Pillow 1034094.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.976 default H conflagrate Fluffy_Pillow 1034094.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.735 default K summon_infernal Fluffy_Pillow 1050664.7/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, backdraft(2), embrace_chaos, accelerando, potion_of_deadly_grace
0:03.494 default N soul_harvest Fluffy_Pillow 1067234.5/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.494 default P dimensional_rift Fluffy_Pillow 1067234.5/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:04.253 default P dimensional_rift Fluffy_Pillow 1083804.3/1100000: 99% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, accelerando, potion_of_deadly_grace
0:05.012 default T incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, accelerando, potion_of_deadly_grace
0:05.759 default T incinerate Fluffy_Pillow 1036503.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:06.512 default H conflagrate Fluffy_Pillow 987184.8/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:07.266 default Q chaos_bolt Fluffy_Pillow 1003888.5/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:08.313 default Q chaos_bolt Fluffy_Pillow 1027113.0/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:09.068 default I conflagrate Fluffy_Pillow 1044081.9/1100000: 95% mana | 0.0/5: 0% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:09.823 default T incinerate Fluffy_Pillow 1061050.7/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:10.576 default C havoc Fluffy_Pillow_Beast1 1011974.6/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:11.332 default F immolate Fluffy_Pillow_Beast1 940965.9/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:12.105 default T incinerate Fluffy_Pillow 891883.8/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:12.861 default I conflagrate Fluffy_Pillow 840235.3/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:13.734 default Q chaos_bolt Fluffy_Pillow 856808.0/1100000: 78% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
0:14.954 default S immolate Fluffy_Pillow 879967.9/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:15.829 default F immolate Fluffy_Pillow_Pack_Beast1 830578.5/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:16.701 default T incinerate Fluffy_Pillow 781133.0/1100000: 71% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:17.454 default I conflagrate Fluffy_Pillow 729638.6/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:18.204 default O rain_of_fire Fluffy_Pillow 744188.4/1100000: 68% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:18.960 default T incinerate Fluffy_Pillow 758963.4/1100000: 69% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:19.716 default J life_tap Fluffy_Pillow 707738.5/1100000: 64% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:20.470 default T incinerate Fluffy_Pillow 1052474.4/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, backdraft, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:21.224 default H conflagrate Fluffy_Pillow 1001210.4/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:21.979 default Q chaos_bolt Fluffy_Pillow 1015965.9/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:22.760 default T incinerate Fluffy_Pillow 1031229.5/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:23.513 default H conflagrate Fluffy_Pillow 979945.9/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:24.277 default F immolate Fluffy_Pillow_Heavy_Spear2 994700.1/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:25.023 default C havoc Fluffy_Pillow_Heavy_Spear2 942796.6/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:25.778 default C havoc Fluffy_Pillow_Heavy_Spear2 869129.2/1100000: 79% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:26.534 default C havoc Fluffy_Pillow_Heavy_Spear2 795480.7/1100000: 72% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:27.277 default C havoc Fluffy_Pillow_Heavy_Spear2 721793.7/1100000: 66% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:28.030 default C havoc Fluffy_Pillow_Heavy_Spear2 648329.6/1100000: 59% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:28.783 default C havoc Fluffy_Pillow_Heavy_Spear2 575046.0/1100000: 52% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3), potion_of_deadly_grace
0:29.782 default C havoc Fluffy_Pillow_Heavy_Spear2 506570.2/1100000: 46% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3), potion_of_deadly_grace
0:30.780 default Q chaos_bolt Fluffy_Pillow 438074.8/1100000: 40% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
0:32.775 default I conflagrate Fluffy_Pillow 477064.5/1100000: 43% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
0:33.772 default Q chaos_bolt Fluffy_Pillow 496549.6/1100000: 45% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
0:34.611 default Q chaos_bolt Fluffy_Pillow 512946.8/1100000: 47% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
0:35.449 default C havoc Fluffy_Pillow_Heavy_Spear1 529324.4/1100000: 48% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
0:36.447 default E immolate Fluffy_Pillow 460829.1/1100000: 42% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:37.330 default F immolate Fluffy_Pillow_Heavy_Spear2 411397.3/1100000: 37% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:38.216 default I conflagrate Fluffy_Pillow 362037.3/1100000: 33% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:39.088 default Q chaos_bolt Fluffy_Pillow 378600.2/1100000: 34% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando(2)
0:39.842 default J life_tap Fluffy_Pillow 393125.1/1100000: 36% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(2)
0:40.703 default T incinerate Fluffy_Pillow 739711.2/1100000: 67% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(2)
0:41.592 default H conflagrate Fluffy_Pillow 686884.7/1100000: 62% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:42.710 default Q chaos_bolt Fluffy_Pillow 703451.6/1100000: 64% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando(2)
0:43.649 default T incinerate Fluffy_Pillow 717366.0/1100000: 65% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando(2)
0:44.588 default H conflagrate Fluffy_Pillow 665280.4/1100000: 60% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:45.707 default O rain_of_fire Fluffy_Pillow 681862.1/1100000: 62% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:46.827 default P dimensional_rift Fluffy_Pillow 698458.6/1100000: 63% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:47.944 default Q chaos_bolt Fluffy_Pillow 715010.7/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
0:49.505 default Q chaos_bolt Fluffy_Pillow 738211.2/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:50.431 default F immolate Fluffy_Pillow_Pack_Beast6 751835.1/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:51.581 default F immolate Fluffy_Pillow_Pack_Beast5 702380.6/1100000: 64% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:52.731 default F immolate Fluffy_Pillow_Pack_Beast1 652944.7/1100000: 59% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:53.865 default E immolate Fluffy_Pillow 603504.1/1100000: 55% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:54.999 default F immolate Fluffy_Pillow_Pack_Beast2 554076.8/1100000: 50% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
0:56.117 default C havoc Fluffy_Pillow_Heavy_Spear2 570643.7/1100000: 52% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
0:57.233 default F immolate Fluffy_Pillow_Heavy_Spear2 499180.9/1100000: 45% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
0:58.351 default F immolate Fluffy_Pillow_Heavy_Spear1 449780.9/1100000: 41% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
0:59.453 default I conflagrate Fluffy_Pillow 400348.0/1100000: 36% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:00.554 default J life_tap Fluffy_Pillow 416900.0/1100000: 38% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(3)
1:01.656 default Q chaos_bolt Fluffy_Pillow 763467.1/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(3)
1:03.195 default T incinerate Fluffy_Pillow 786603.8/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:04.119 default I conflagrate Fluffy_Pillow 734494.9/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:05.244 default Q chaos_bolt Fluffy_Pillow 751020.6/1100000: 68% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos
1:06.212 default T incinerate Fluffy_Pillow 764947.7/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
1:07.181 default H conflagrate Fluffy_Pillow 712889.1/1100000: 65% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:08.331 default Q chaos_bolt Fluffy_Pillow 729435.7/1100000: 66% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando
1:09.283 default S immolate Fluffy_Pillow 743337.5/1100000: 68% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
1:10.417 default T incinerate Fluffy_Pillow 693896.9/1100000: 63% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
1:11.369 default H conflagrate Fluffy_Pillow 641798.7/1100000: 58% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:12.503 default T incinerate Fluffy_Pillow 658358.2/1100000: 60% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:13.455 default T incinerate Fluffy_Pillow 606260.0/1100000: 55% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando
1:14.409 default R conflagrate Fluffy_Pillow 554191.0/1100000: 50% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:15.543 default F immolate Fluffy_Pillow_Heavy_Spear1 570750.5/1100000: 52% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
1:16.677 default F immolate Fluffy_Pillow_Pack_Beast1 521419.1/1100000: 47% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
1:17.431 default F immolate Fluffy_Pillow_Pack_Beast2 466754.4/1100000: 42% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
1:18.183 default F immolate Fluffy_Pillow_Pack_Beast3 412066.4/1100000: 37% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
1:18.938 default F immolate Fluffy_Pillow_Pack_Beast4 357579.6/1100000: 33% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
1:19.692 default F immolate Fluffy_Pillow_Pack_Beast5 303077.5/1100000: 28% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
1:20.453 default F immolate Fluffy_Pillow_Pack_Beast6 248572.7/1100000: 23% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact
1:21.210 default F immolate Fluffy_Pillow_Heavy_Spear2 193464.0/1100000: 18% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact
1:21.966 default F immolate Fluffy_Pillow_Beast1 138340.8/1100000: 13% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
1:22.723 default J life_tap Fluffy_Pillow 83232.1/1100000: 8% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
1:23.481 default O rain_of_fire Fluffy_Pillow 424137.8/1100000: 39% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
1:24.240 default Q chaos_bolt Fluffy_Pillow 435057.8/1100000: 40% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
1:25.752 default C havoc Fluffy_Pillow_Beast1 456811.6/1100000: 42% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:26.509 default I conflagrate Fluffy_Pillow 379708.2/1100000: 35% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:27.261 default S immolate Fluffy_Pillow 390689.5/1100000: 36% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:28.014 default T incinerate Fluffy_Pillow 335737.9/1100000: 31% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:28.767 default Q chaos_bolt Fluffy_Pillow 280896.1/1100000: 26% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:29.872 default H conflagrate Fluffy_Pillow 297270.4/1100000: 27% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:31.188 default P dimensional_rift Fluffy_Pillow 316771.3/1100000: 29% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:32.506 default T incinerate Fluffy_Pillow 336301.8/1100000: 31% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:33.611 default T incinerate Fluffy_Pillow 286676.9/1100000: 26% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
1:34.701 default H conflagrate Fluffy_Pillow 237063.6/1100000: 22% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(3)
1:35.997 default F immolate Fluffy_Pillow_Heavy_Spear1 256547.2/1100000: 23% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
1:37.294 default C havoc Fluffy_Pillow_Heavy_Spear2 210045.8/1100000: 19% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
1:38.048 default C havoc Fluffy_Pillow_Heavy_Spear2 133381.1/1100000: 12% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
1:38.817 default Q chaos_bolt Fluffy_Pillow 56726.8/1100000: 5% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact
1:39.877 default F immolate Fluffy_Pillow_Heavy_Spear2 71977.5/1100000: 7% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:40.634 default U life_tap Fluffy_Pillow 16869.6/1100000: 2% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:41.390 default C havoc Fluffy_Pillow_Heavy_Spear2 357909.3/1100000: 33% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:42.144 default C havoc Fluffy_Pillow_Heavy_Spear2 280919.7/1100000: 26% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:42.897 default C havoc Fluffy_Pillow_Heavy_Spear2 203915.6/1100000: 19% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:43.652 default C havoc Fluffy_Pillow_Heavy_Spear2 126940.6/1100000: 12% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:44.400 default Q chaos_bolt Fluffy_Pillow 49957.9/1100000: 5% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
1:45.868 default F immolate Fluffy_Pillow_Pack_Beast1 71875.0/1100000: 7% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:46.623 default I conflagrate Fluffy_Pillow 17225.4/1100000: 2% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:47.379 default U life_tap Fluffy_Pillow 28590.8/1100000: 3% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:48.134 default Q chaos_bolt Fluffy_Pillow 369941.2/1100000: 34% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:48.888 default E immolate Fluffy_Pillow 381276.6/1100000: 35% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:49.640 default T incinerate Fluffy_Pillow 326622.0/1100000: 30% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
1:50.716 default Q chaos_bolt Fluffy_Pillow 277030.1/1100000: 25% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
1:52.250 default I conflagrate Fluffy_Pillow 300422.4/1100000: 27% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
1:53.581 default T incinerate Fluffy_Pillow 319899.6/1100000: 29% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:54.719 default Q chaos_bolt Fluffy_Pillow 270272.5/1100000: 25% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:55.857 default C havoc Fluffy_Pillow_Heavy_Spear1 286645.3/1100000: 26% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:57.213 default F immolate Fluffy_Pillow_Heavy_Spear1 218154.7/1100000: 20% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:58.569 default F immolate Fluffy_Pillow_Heavy_Spear2 171835.8/1100000: 16% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:59.703 default I conflagrate Fluffy_Pillow 122396.4/1100000: 11% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:00.821 default T incinerate Fluffy_Pillow 138963.3/1100000: 13% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
2:01.761 default T incinerate Fluffy_Pillow 87094.4/1100000: 8% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:02.686 default R conflagrate Fluffy_Pillow 35000.5/1100000: 3% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:03.788 default N soul_harvest Fluffy_Pillow 51567.6/1100000: 5% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(3)
2:03.788 default Q chaos_bolt Fluffy_Pillow 51567.6/1100000: 5% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, accelerando(3)
2:05.330 default S immolate Fluffy_Pillow 75003.4/1100000: 7% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(4)
2:06.416 default U life_tap Fluffy_Pillow 25564.1/1100000: 2% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(4)
2:07.502 default T incinerate Fluffy_Pillow 372124.7/1100000: 34% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(4)
2:08.414 default H conflagrate Fluffy_Pillow 320032.0/1100000: 29% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4)
2:09.501 default Q chaos_bolt Fluffy_Pillow 336607.9/1100000: 31% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(4)
2:11.020 default T incinerate Fluffy_Pillow 358695.1/1100000: 33% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:11.987 default T incinerate Fluffy_Pillow 306607.7/1100000: 28% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:13.138 default U life_tap Fluffy_Pillow 323167.7/1100000: 29% mana | 1.0/5: 20% soul_shard raid_movement, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:14.274 default Q chaos_bolt Fluffy_Pillow 669727.9/1100000: 61% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:15.632 default F immolate Fluffy_Pillow_Heavy_Spear2 689573.3/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:16.750 default F immolate Fluffy_Pillow_Pack_Beast1 640140.2/1100000: 58% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:17.867 default F immolate Fluffy_Pillow_Pack_Beast2 590692.2/1100000: 54% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:18.985 default F immolate Fluffy_Pillow_Pack_Beast3 541259.1/1100000: 49% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:20.101 default F immolate Fluffy_Pillow_Pack_Beast4 491796.4/1100000: 45% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:21.218 default F immolate Fluffy_Pillow_Pack_Beast5 442353.0/1100000: 40% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:22.318 default F immolate Fluffy_Pillow_Pack_Beast6 392889.9/1100000: 36% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:23.419 default F immolate Fluffy_Pillow_Heavy_Spear1 343442.0/1100000: 31% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:24.521 default E immolate Fluffy_Pillow 294009.0/1100000: 27% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:25.637 default C havoc Fluffy_Pillow_Beast1 244553.5/1100000: 22% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:26.771 default F immolate Fluffy_Pillow_Beast1 173113.0/1100000: 16% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:27.904 default H conflagrate Fluffy_Pillow 123657.9/1100000: 11% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:29.036 default P dimensional_rift Fluffy_Pillow 140188.1/1100000: 13% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
2:30.170 default Q chaos_bolt Fluffy_Pillow 156747.6/1100000: 14% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
2:31.754 default Q chaos_bolt Fluffy_Pillow 179878.3/1100000: 16% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
2:32.708 default H conflagrate Fluffy_Pillow 193809.3/1100000: 18% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:33.841 default Q chaos_bolt Fluffy_Pillow 210354.2/1100000: 19% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:34.793 default T incinerate Fluffy_Pillow 224281.0/1100000: 20% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:35.733 default F immolate Fluffy_Pillow_Heavy_Spear1 172211.3/1100000: 16% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:36.835 default I conflagrate Fluffy_Pillow 122778.4/1100000: 11% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:37.950 default Q chaos_bolt Fluffy_Pillow 139326.3/1100000: 13% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos
2:38.918 default J life_tap Fluffy_Pillow 153253.3/1100000: 14% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
2:40.068 default Q chaos_bolt Fluffy_Pillow 499798.8/1100000: 45% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
2:41.036 default H conflagrate Fluffy_Pillow 513725.9/1100000: 47% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:42.186 default C havoc Fluffy_Pillow_Heavy_Spear2 530271.4/1100000: 48% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos
2:43.336 default C havoc Fluffy_Pillow_Heavy_Spear2 458816.9/1100000: 42% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos
2:44.471 default C havoc Fluffy_Pillow_Heavy_Spear2 387391.0/1100000: 35% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando
2:45.605 default E immolate Fluffy_Pillow 315950.5/1100000: 29% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
2:46.738 default Q chaos_bolt Fluffy_Pillow 266495.4/1100000: 24% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
2:48.324 default T incinerate Fluffy_Pillow 289655.3/1100000: 26% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
2:49.279 default H conflagrate Fluffy_Pillow 237600.9/1100000: 22% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:50.412 default T incinerate Fluffy_Pillow 254145.8/1100000: 23% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:51.366 default P dimensional_rift Fluffy_Pillow 202101.3/1100000: 18% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:52.482 default T incinerate Fluffy_Pillow 218638.6/1100000: 20% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:53.266 default U life_tap Fluffy_Pillow 230256.1/1100000: 21% mana | 1.0/5: 20% soul_shard raid_movement, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:54.383 default T incinerate Fluffy_Pillow 576808.2/1100000: 52% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:55.324 default C havoc Fluffy_Pillow_Heavy_Spear1 524752.2/1100000: 48% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:56.474 default F immolate Fluffy_Pillow_Heavy_Spear1 453302.9/1100000: 41% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
2:57.626 default F immolate Fluffy_Pillow_Heavy_Spear2 403878.5/1100000: 37% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:58.760 default I conflagrate Fluffy_Pillow 354439.1/1100000: 32% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:59.877 default P dimensional_rift Fluffy_Pillow 370991.2/1100000: 34% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
3:01.104 default Q chaos_bolt Fluffy_Pillow 389348.7/1100000: 35% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(3)
3:02.643 default E immolate Fluffy_Pillow 412485.5/1100000: 37% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:03.747 default G berserking Fluffy_Pillow 363198.6/1100000: 33% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:03.747 default M summon_infernal Fluffy_Pillow 363198.6/1100000: 33% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:04.691 default Q chaos_bolt Fluffy_Pillow 379753.1/1100000: 35% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:05.486 default I conflagrate Fluffy_Pillow 393694.7/1100000: 36% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:06.430 default T incinerate Fluffy_Pillow 410249.3/1100000: 37% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:07.226 default Q chaos_bolt Fluffy_Pillow 358208.4/1100000: 33% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:08.019 default I conflagrate Fluffy_Pillow 372115.0/1100000: 34% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:08.956 default Q chaos_bolt Fluffy_Pillow 388666.6/1100000: 35% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:09.740 default T incinerate Fluffy_Pillow 402460.8/1100000: 37% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:10.582 default R conflagrate Fluffy_Pillow 350392.1/1100000: 32% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:11.581 default Q chaos_bolt Fluffy_Pillow 366921.1/1100000: 33% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
3:12.423 default T incinerate Fluffy_Pillow 380852.4/1100000: 35% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:13.263 default T incinerate Fluffy_Pillow 328750.7/1100000: 30% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:14.465 default R conflagrate Fluffy_Pillow 281115.6/1100000: 26% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:15.597 default F immolate Fluffy_Pillow_Heavy_Spear2 297645.9/1100000: 27% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando
3:16.730 default F immolate Fluffy_Pillow_Pack_Beast1 248190.7/1100000: 23% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
3:17.865 default F immolate Fluffy_Pillow_Pack_Beast2 198764.8/1100000: 18% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
3:18.998 default F immolate Fluffy_Pillow_Pack_Beast3 149309.7/1100000: 14% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
3:20.130 default F immolate Fluffy_Pillow_Pack_Beast4 99842.6/1100000: 9% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, accelerando(2)
3:21.249 default J life_tap Fluffy_Pillow 50424.3/1100000: 5% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, accelerando(2)
3:22.366 default E immolate Fluffy_Pillow 396976.3/1100000: 36% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:23.484 default F immolate Fluffy_Pillow_Pack_Beast5 347543.2/1100000: 32% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:24.602 default F immolate Fluffy_Pillow_Pack_Beast6 298115.1/1100000: 27% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:25.703 default C havoc Fluffy_Pillow_Heavy_Spear2 314667.1/1100000: 29% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:26.824 default H conflagrate Fluffy_Pillow 243207.7/1100000: 22% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
3:27.975 default Q chaos_bolt Fluffy_Pillow 259767.6/1100000: 24% mana | 5.0/5: 100% soul_shard empowered_life_tap, backdraft(2), lord_of_flames
3:29.584 default Q chaos_bolt Fluffy_Pillow 282917.8/1100000: 26% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
3:30.539 default H conflagrate Fluffy_Pillow 296863.4/1100000: 27% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:31.671 default Q chaos_bolt Fluffy_Pillow 313393.7/1100000: 28% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, embrace_chaos, accelerando
3:32.625 default T incinerate Fluffy_Pillow 327324.7/1100000: 30% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, accelerando
3:33.576 default T incinerate Fluffy_Pillow 275211.8/1100000: 25% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:34.935 default H conflagrate Fluffy_Pillow 229056.9/1100000: 21% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:36.069 default C havoc Fluffy_Pillow_Heavy_Spear1 245616.4/1100000: 22% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:37.202 default C havoc Fluffy_Pillow_Heavy_Spear1 174161.3/1100000: 16% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
3:38.335 default C havoc Fluffy_Pillow_Heavy_Spear1 102706.2/1100000: 9% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
3:39.453 default U life_tap Fluffy_Pillow 31273.1/1100000: 3% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
3:40.572 default C havoc Fluffy_Pillow_Heavy_Spear1 377854.8/1100000: 34% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
3:41.676 default C havoc Fluffy_Pillow_Heavy_Spear1 306389.9/1100000: 28% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos
3:42.826 default C havoc Fluffy_Pillow_Heavy_Spear1 234935.4/1100000: 21% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:43.976 default C havoc Fluffy_Pillow_Heavy_Spear1 163480.9/1100000: 15% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:45.127 default E immolate Fluffy_Pillow 92040.8/1100000: 8% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:46.276 default I conflagrate Fluffy_Pillow 42572.6/1100000: 4% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:47.411 default P dimensional_rift Fluffy_Pillow 59146.7/1100000: 5% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
3:48.544 default F immolate Fluffy_Pillow_Pack_Beast6 75691.6/1100000: 7% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
3:49.677 default O rain_of_fire Fluffy_Pillow 26236.4/1100000: 2% mana | 3.0/5: 60% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
3:50.810 default U life_tap Fluffy_Pillow 42781.3/1100000: 4% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando
3:51.943 default T incinerate Fluffy_Pillow 389328.6/1100000: 35% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, accelerando(2)
3:52.882 default T incinerate Fluffy_Pillow 337243.8/1100000: 31% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, accelerando(3)
3:53.808 default H conflagrate Fluffy_Pillow 285165.0/1100000: 26% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:54.910 default T incinerate Fluffy_Pillow 301732.0/1100000: 27% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(3)
3:55.835 default C havoc Fluffy_Pillow_Heavy_Spear2 249638.1/1100000: 23% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:56.935 default F immolate Fluffy_Pillow_Heavy_Spear2 178175.1/1100000: 16% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:58.036 default F immolate Fluffy_Pillow_Heavy_Spear1 128848.3/1100000: 12% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:59.173 default S immolate Fluffy_Pillow 79411.1/1100000: 7% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos
4:00.326 default Q chaos_bolt Fluffy_Pillow 29999.8/1100000: 3% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos
4:01.937 default I conflagrate Fluffy_Pillow 53177.9/1100000: 5% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:03.088 default Q chaos_bolt Fluffy_Pillow 69737.8/1100000: 6% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
4:04.056 default N soul_harvest Fluffy_Pillow 83665.9/1100000: 8% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:04.056 default Q chaos_bolt Fluffy_Pillow 83665.9/1100000: 8% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:05.008 default R conflagrate Fluffy_Pillow 97567.7/1100000: 9% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:06.142 default Q chaos_bolt Fluffy_Pillow 114127.2/1100000: 10% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:07.093 default T incinerate Fluffy_Pillow 128014.3/1100000: 12% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:08.045 default P dimensional_rift Fluffy_Pillow 75917.0/1100000: 7% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:09.162 default R conflagrate Fluffy_Pillow 92469.1/1100000: 8% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:10.279 default Q chaos_bolt Fluffy_Pillow 109021.1/1100000: 10% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando(2)
4:11.217 default T incinerate Fluffy_Pillow 122920.7/1100000: 11% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:11.970 default T incinerate Fluffy_Pillow 68078.9/1100000: 6% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:12.851 default U life_tap Fluffy_Pillow 15134.5/1100000: 1% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:13.604 default T incinerate Fluffy_Pillow 356454.8/1100000: 32% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:14.474 default T incinerate Fluffy_Pillow 303534.1/1100000: 28% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:15.344 default F immolate Fluffy_Pillow_Heavy_Spear1 250613.3/1100000: 23% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3)
4:16.102 default F immolate Fluffy_Pillow_Pack_Beast1 195975.8/1100000: 18% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact
4:16.860 default F immolate Fluffy_Pillow_Pack_Beast2 140882.6/1100000: 13% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando
4:17.612 default F immolate Fluffy_Pillow_Pack_Beast3 85863.8/1100000: 8% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando
4:18.366 default H conflagrate Fluffy_Pillow 30876.9/1100000: 3% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2)
4:19.121 default O rain_of_fire Fluffy_Pillow 42064.7/1100000: 4% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
4:19.879 default U life_tap Fluffy_Pillow 53297.0/1100000: 5% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
4:20.635 default F immolate Fluffy_Pillow_Pack_Beast4 394499.6/1100000: 36% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
4:21.391 default E immolate Fluffy_Pillow 339702.3/1100000: 31% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
4:22.145 default F immolate Fluffy_Pillow_Pack_Beast5 284875.3/1100000: 26% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
4:22.900 default F immolate Fluffy_Pillow_Pack_Beast6 230063.1/1100000: 21% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
4:23.655 default F immolate Fluffy_Pillow_Heavy_Spear2 175251.0/1100000: 16% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
4:24.971 default O rain_of_fire Fluffy_Pillow 128751.9/1100000: 12% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
4:26.283 default C havoc Fluffy_Pillow_Heavy_Spear2 148239.4/1100000: 13% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
4:27.581 default I conflagrate Fluffy_Pillow 79753.0/1100000: 7% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
4:28.879 default Q chaos_bolt Fluffy_Pillow 99251.2/1100000: 9% mana | 4.0/5: 80% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, devils_due
4:30.773 default P dimensional_rift Fluffy_Pillow 126500.9/1100000: 12% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos, devils_due
4:32.129 default Q chaos_bolt Fluffy_Pillow 146010.2/1100000: 13% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft, lord_of_flames, embrace_chaos
4:33.097 default H conflagrate Fluffy_Pillow 159938.3/1100000: 15% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:34.230 default Q chaos_bolt Fluffy_Pillow 176483.2/1100000: 16% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:35.184 default C havoc Fluffy_Pillow_Heavy_Spear1 190414.2/1100000: 17% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:36.319 default C havoc Fluffy_Pillow_Heavy_Spear1 118988.3/1100000: 11% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:37.451 default U life_tap Fluffy_Pillow 47518.6/1100000: 4% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:38.581 default C havoc Fluffy_Pillow_Heavy_Spear1 394046.0/1100000: 36% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:39.699 default C havoc Fluffy_Pillow_Heavy_Spear1 322612.8/1100000: 29% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:40.816 default C havoc Fluffy_Pillow_Heavy_Spear1 251164.9/1100000: 23% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:41.919 default C havoc Fluffy_Pillow_Heavy_Spear1 179747.0/1100000: 16% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:43.005 default C havoc Fluffy_Pillow_Heavy_Spear1 108307.7/1100000: 10% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:44.092 default I conflagrate Fluffy_Pillow 36883.6/1100000: 3% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:45.184 default Q chaos_bolt Fluffy_Pillow 53456.4/1100000: 5% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos
4:46.794 default E immolate Fluffy_Pillow 76621.2/1100000: 7% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:47.928 default U life_tap Fluffy_Pillow 27180.7/1100000: 2% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:49.061 default F immolate Fluffy_Pillow_Heavy_Spear2 373725.6/1100000: 34% mana | 0.0/5: 0% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:50.195 default T incinerate Fluffy_Pillow 390285.1/1100000: 35% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:51.146 default I conflagrate Fluffy_Pillow 338172.3/1100000: 31% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:52.281 default Q chaos_bolt Fluffy_Pillow 354746.4/1100000: 32% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
4:53.074 default U life_tap Fluffy_Pillow 366326.3/1100000: 33% mana | 2.0/5: 40% soul_shard raid_movement, empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
4:54.206 default Q chaos_bolt Fluffy_Pillow 712856.6/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
4:55.790 default C havoc Fluffy_Pillow_Heavy_Spear2 736223.0/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:56.891 default F immolate Fluffy_Pillow_Heavy_Spear2 664775.0/1100000: 60% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:57.991 default F immolate Fluffy_Pillow_Heavy_Spear1 615312.0/1100000: 56% mana | 1.0/5: 20% soul_shard empowered_life_tap, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:59.104 default I conflagrate Fluffy_Pillow 565840.8/1100000: 51% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
5:00.253 default Q chaos_bolt Fluffy_Pillow 582372.0/1100000: 53% mana | 2.0/5: 40% soul_shard empowered_life_tap, backdraft(2), lord_of_flames

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51868 51868 33640
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3112080 3112080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 13.94% 13.94% 3577
Haste 30.79% 29.79% 11173
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14387 14277 0
Mastery 67.65% 67.65% 5819
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 905.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="BD/ELT/SH/Sac/WH"
level=110
race=troll
role=spell
position=back
talents=1303031
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=904.60
# gear_stamina=33640
# gear_intellect=38456
# gear_crit_rating=3577
# gear_haste_rating=11173
# gear_mastery_rating=5819
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

RB/ELT/SH/Sac/CDF : 846502 dps, 433998 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
846501.9 846501.9 828.7 / 0.098% 165236.7 / 19.5% 26.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
27818.2 27818.2 Mana 0.00% 50.1 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Sacrifice
  • 100: Channel Demonfire (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
RB/ELT/SH/Sac/CDF 846502
Channel Demonfire 0 (126969) 0.0% (15.0%) 21.9 13.77sec 1743139 772336

Stats details: channel_demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.87 0.00 325.09 0.00 2.2570 0.1347 0.00 0.00 0.00 772335.83 772335.83
 
 

Action details: channel_demonfire

Static Values
  • id:196447
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:52800.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.immolate.remains>cast_time
Spelldata
  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Channel Demonfire (_tick) 126969 15.0% 0.0 0.00sec 0 0 Direct 872.2 38355 76777 43716 14.0%  

Stats details: channel_demonfire_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 872.16 0.00 0.00 0.0000 0.0000 38127130.83 38127130.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 750.47 86.05% 38355.44 18254 80790 38589.09 34187 49069 28784625 28784625 0.00
crit 121.69 13.95% 76776.54 36511 161581 77238.47 64598 101423 9342506 9342506 0.00
 
 

Action details: channel_demonfire_tick

Static Values
  • id:196448
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.640000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Chaos Bolt 119123 14.1% 36.3 7.97sec 986116 629134 Direct 45.8 0 780810 780810 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.29 45.84 0.00 0.00 1.5674 0.0000 35790800.97 35790800.97 0.00 629133.94 629133.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 45.84 100.00% 780809.71 511926 1132770 781156.93 704128 868763 35790801 35790801 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 66616 7.9% 48.5 6.19sec 411926 405644 Direct 60.7 194204 435989 329202 55.8%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.53 60.72 0.00 0.00 1.0155 0.0000 19988936.46 19988936.46 0.00 405644.35 405644.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.82 44.17% 194203.83 129241 285981 194219.08 169528 217113 5207968 5207968 0.00
crit 33.90 55.83% 435988.64 258503 651721 436003.08 386274 489785 14780968 14780968 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 8191 1.0% 20.2 1.48sec 119516 0 Direct 20.0 105845 211575 120700 14.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.22 20.02 0.00 0.00 0.0000 0.0000 2416753.05 2416753.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.21 85.95% 105844.65 87244 115162 105837.05 98040 112603 1821573 1821573 0.00
crit 2.81 14.05% 211575.40 174488 230324 200056.13 0 230324 595180 595180 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Demonic Power 121061 14.3% 141.5 2.12sec 256726 0 Direct 456.6 69830 139669 79571 13.9%  

Stats details: demonic_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.53 456.64 0.00 0.00 0.0000 0.0000 36335174.13 36335174.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 392.95 86.05% 69829.80 61705 81451 69824.86 66772 72787 27439792 27439792 0.00
crit 63.69 13.95% 139669.47 123410 162902 139653.66 131527 149351 8895383 8895383 0.00
 
 

Action details: demonic_power

Static Values
  • id:196100
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196100
  • name:Demonic Power
  • school:shadow
  • tooltip:
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 240852 28.5% 90.8 3.27sec 796547 762185 Direct 99.0 134335 268580 196012 45.9%  
Periodic 345.7 104858 209774 153066 45.9% 228.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.80 99.04 345.68 345.68 1.0451 1.9919 72324479.54 72324479.54 0.00 92312.90 762184.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.53 54.06% 134334.82 89660 198414 134360.31 123122 146950 7191444 7191444 0.00
crit 45.50 45.94% 268579.84 179319 396826 268613.04 232159 299278 12220803 12220803 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 186.8 54.05% 104857.99 85 409970 105024.98 91608 120556 19592201 19592201 0.00
crit 158.8 45.95% 209773.96 118 819919 210150.90 178903 252587 33320031 33320031 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 3907 0.5% 4.1 36.73sec 286898 253071 Direct 4.7 220015 439769 251280 14.2%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.09 4.67 0.00 0.00 1.1339 0.0000 1172985.88 1172985.88 0.00 253071.39 253071.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.00 85.77% 220014.67 144998 320721 201465.97 0 320576 880943 880943 0.00
crit 0.66 14.23% 439768.98 290349 641444 197966.07 0 640976 292043 292043 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9491 1.1% 20.2 14.77sec 141208 0 Direct 20.2 123855 247712 141210 14.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.18 20.18 0.00 0.00 0.0000 0.0000 2850165.45 2850165.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.36 85.99% 123855.35 109698 144802 123849.49 115183 134459 2149642 2149642 0.00
crit 2.83 14.01% 247711.61 219396 289603 234344.59 0 289603 700523 700523 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Rain of Fire 41314 4.9% 6.7 30.50sec 1845013 1806733 Periodic 231.5 46967 93872 53507 13.9% 0.0%

Stats details: rain_of_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.71 0.00 0.00 231.47 1.0213 0.0000 12385153.46 12385153.46 0.00 1806732.82 1806732.82
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.2 86.06% 46967.46 31660 70059 46873.44 0 56883 9355742 9355742 0.00
crit 32.3 13.94% 93872.50 63320 140117 93603.96 0 126170 3029412 3029412 0.00
 
 

Action details: rain_of_fire

Static Values
  • id:5740
  • school:fire
  • resource:soul_shard
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
Spelldata
  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.
 
pet - infernal 157006 / 26646
Immolation 137162 2.7% 2.0 181.58sec 3364936 0 Periodic 161.6 37326 74629 42505 13.9% 16.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 39.34 161.59 0.0000 1.2341 6868521.09 6868521.09 0.00 141467.32 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 139.2 86.12% 37326.18 34281 41137 37332.49 36566 39818 5194286 5194286 0.00
crit 22.4 13.88% 74628.96 68561 82274 74644.36 69368 81027 1674235 1674235 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 19844 0.4% 39.3 5.45sec 25258 20468 Direct 39.3 22172 44338 25258 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.34 39.34 0.00 0.00 1.2341 0.0000 993749.10 1460905.31 31.98 20467.73 20467.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.87 86.08% 22172.12 20500 24600 22173.08 21457 23876 750865 1103843 31.98
crit 5.48 13.92% 44337.64 41000 49200 44268.78 0 49200 242884 357062 31.92
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 56641 / 5804
Doom Bolt 56641 0.6% 6.5 2.20sec 218849 99647 Direct 6.5 181003 362007 218849 20.9%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.47 6.47 0.00 0.00 2.1963 0.0000 1416084.38 1416084.38 0.00 99647.06 99647.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.12 79.09% 181003.27 181003 181003 106472.51 0 181003 926311 926311 0.00
crit 1.35 20.91% 362006.53 362007 362007 191650.52 0 362007 489774 489774 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 196614 / 16662
Immolation 172777 1.7% 1.0 0.00sec 4319592 0 Periodic 96.2 39388 78785 44883 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.29 96.24 0.0000 1.0896 4319592.22 4319592.22 0.00 177826.86 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.8 86.05% 39388.20 34281 41137 39402.01 38379 40229 3262107 3262107 0.00
crit 13.4 13.95% 78785.21 68561 82274 78812.88 71304 82274 1057485 1057485 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23837 0.2% 22.3 1.09sec 26732 24534 Direct 22.3 23446 46878 26732 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.29 22.29 0.00 0.00 1.0896 0.0000 595952.68 876106.88 31.98 24533.89 24533.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.17 85.97% 23445.54 20500 24600 23446.80 22687 24285 449378 660629 31.98
crit 3.13 14.03% 46877.60 41000 49200 45263.91 0 49200 146574 215478 30.87
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 196673 / 16669
Immolation 172831 1.7% 1.0 0.00sec 4320946 0 Periodic 96.2 39387 78796 44897 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.29 96.24 0.0000 1.0896 4320945.76 4320945.76 0.00 177882.58 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.8 86.02% 39387.30 34281 41137 39400.90 38347 40396 3260754 3260754 0.00
crit 13.5 13.98% 78796.21 68561 82274 78832.26 70520 82274 1060192 1060192 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23842 0.2% 22.3 1.09sec 26738 24539 Direct 22.3 23445 46887 26737 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.29 22.29 0.00 0.00 1.0896 0.0000 596080.20 876294.35 31.98 24539.14 24539.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.16 85.95% 23444.77 20500 24600 23446.08 22806 24307 449251 660441 31.98
crit 3.13 14.05% 46887.15 41000 49200 45324.26 0 49200 146830 215853 30.90
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 196590 / 16661
Immolation 172794 1.7% 1.0 0.00sec 4320015 0 Periodic 96.2 39390 78768 44887 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.29 96.24 0.0000 1.0896 4320014.60 4320014.60 0.00 177844.25 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.8 86.04% 39389.61 34281 41137 39403.51 38306 40318 3261685 3261685 0.00
crit 13.4 13.96% 78767.82 68561 82274 78792.79 70520 82274 1058330 1058330 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23796 0.2% 22.3 1.09sec 26686 24491 Direct 22.3 23444 46899 26686 13.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.29 22.29 0.00 0.00 1.0896 0.0000 594920.61 874589.64 31.98 24491.40 24491.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.21 86.18% 23443.84 20500 24600 23444.80 22806 24307 450410 662146 31.98
crit 3.08 13.82% 46898.66 41000 49200 45342.90 0 49200 144510 212444 30.92
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 113859 / 14175
Shadow Bolt 113859 1.7% 3.2 82.61sec 1344107 0 Periodic 34.3 108362 216635 123520 14.0% 14.2%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.15 0.00 34.28 34.28 0.0000 1.2463 4234048.74 4234048.74 0.00 99113.95 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.5 86.00% 108362.17 225 126576 107962.24 0 126576 3194336 3194336 0.00
crit 4.8 14.00% 216635.33 231 253152 207823.01 0 253152 1039713 1039713 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 132148 / 6581
Chaos Bolt 132148 0.8% 3.1 80.35sec 630730 306110 Direct 3.1 0 630737 630737 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.12 3.12 0.00 0.00 2.0607 0.0000 1969205.09 1969205.09 0.00 306109.92 306109.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.12 100.00% 630737.20 600929 721115 631236.11 0 721115 1969205 1969205 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 228508 / 12424
Chaos Barrage 228508 1.5% 3.2 84.24sec 1177970 0 Periodic 107.4 30329 60662 34566 14.0% 5.7%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.15 0.00 107.40 107.40 0.0000 0.1593 3712283.45 3712283.45 0.00 217016.45 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.4 86.03% 30328.89 152 34809 30222.21 0 34809 2802294 2802294 0.00
crit 15.0 13.97% 60662.50 304 69619 60418.76 0 69619 909989 909989 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
RB/ELT/SH/Sac/CDF
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Sac/CDF
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.76sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 9.2 37.76sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.21 0.00 0.00 0.00 0.9961 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Sac/CDF
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Sac/CDF
  • harmful:false
  • if_expr:
 
Grimoire of Sacrifice 1.0 0.00sec

Stats details: grimoire_of_sacrifice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_of_sacrifice

Static Values
  • id:108503
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_sacrifice.enabled
Spelldata
  • id:108503
  • name:Grimoire of Sacrifice
  • school:shadow
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.
 
Havoc 10.8 28.17sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 0.00 0.00 0.00 1.0343 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 14.1 21.92sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.15 0.00 0.00 0.00 0.9798 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 2.9 121.49sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 0.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.9951 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 2.0 181.58sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.8573 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.0 0.0 15.4sec 15.4sec 78.36% 78.36% 1.7(1.7) 19.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.53%
  • accelerando_2:24.19%
  • accelerando_3:14.56%
  • accelerando_4:6.73%
  • accelerando_5:3.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.8sec 180.8sec 6.86% 7.45% 0.0(0.0) 2.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 13.34% 0.0(0.0) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.3 0.0 12.3sec 12.3sec 49.62% 48.53% 0.0(0.0) 0.2

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.62%

Trigger Attempt Success

  • trigger_pct:50.06%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.8sec 69.8sec 8.71% 8.71% 0.0(0.0) 3.2

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.71%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 20.9 16.4 14.6sec 7.9sec 38.30% 52.31% 16.4(16.4) 20.5

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:38.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 10.0 4.1 31.3sec 21.9sec 90.18% 90.50% 51.8(51.8) 9.1

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:90.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 98.30% 50.75% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:98.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.2sec 69.4sec 13.57% 13.57% 0.0(0.0) 3.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.57%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.17% 10.17% 0.0(0.0) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 1.5 0.0 86.2sec 86.2sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.50%
Soul Harvest 2.9 0.0 121.5sec 121.5sec 17.68% 17.68% 0.0(0.0) 2.7

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Demonic Power

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • demonic_power_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196099
  • name:Demonic Power
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.1 79.1sec
chaos_tear 3.1 79.1sec
chaos_portal 3.1 78.9sec
dimension_ripper 0.2 97.1sec

Resources

Resource Usage Type Count Total Average RPE APR
RB/ELT/SH/Sac/CDF
channel_demonfire Mana 21.9 1154875.3 52800.0 52799.9 33.0
chaos_bolt Soul Shard 37.3 74.6 2.0 2.1 479833.6
havoc Mana 10.8 949719.1 88000.0 88000.7 0.0
immolate Mana 90.8 5992566.4 66000.0 65999.3 12.1
incinerate Mana 4.1 269878.8 66000.0 66009.1 4.3
rain_of_fire Soul Shard 6.7 20.1 3.0 3.0 615003.1
summon_doomguard Soul Shard 0.0 0.0 1.0 1.0 0.0
summon_infernal Soul Shard 2.0 2.0 1.0 1.0 0.0
pet - doomguard
doom_bolt Energy 0.0 0.4 35.0 0.1 3679244.7
Resource Gains Type Count Total Average Overflow
life_tap Mana 14.15 3754541.17 (46.71%) 265363.81 914515.11 19.59%
immolate Soul Shard 75.64 49.18 (50.45%) 0.65 26.46 34.98%
conflagrate Soul Shard 48.53 42.70 (43.80%) 0.88 5.83 12.01%
mp5_regen Mana 829.15 4283965.95 (53.29%) 5166.68 381271.21 8.17%
soulsnatcher Soul Shard 5.61 5.61 (5.75%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 0.01 0.35 (100.00%) 31.82 0.04 10.65%
Resource RPS-Gain RPS-Loss
Health 0.00 14639.09
Mana 26726.07 27818.17
Soul Shard 0.32 0.32
Combat End Resource Mean Min Max
Mana 769574.99 42631.37 1100000.00
Soul Shard 3.77 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 7.4%

Statistics & Data Analysis

Fight Length
Sample Data RB/ELT/SH/Sac/CDF Fight Length
Count 9999
Mean 300.78
Minimum 214.57
Maximum 375.75
Spread ( max - min ) 161.18
Range [ ( max - min ) / 2 * 100% ] 26.79%
DPS
Sample Data RB/ELT/SH/Sac/CDF Damage Per Second
Count 9999
Mean 846501.89
Minimum 709370.07
Maximum 1001060.85
Spread ( max - min ) 291690.78
Range [ ( max - min ) / 2 * 100% ] 17.23%
Standard Deviation 42279.5655
5th Percentile 780286.29
95th Percentile 920224.57
( 95th Percentile - 5th Percentile ) 139938.28
Mean Distribution
Standard Deviation 422.8168
95.00% Confidence Intervall ( 845673.18 - 847330.59 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 96
0.1% Error 9583
0.1 Scale Factor Error with Delta=300 15259655
0.05 Scale Factor Error with Delta=300 61038618
0.01 Scale Factor Error with Delta=300 1525965450
Priority Target DPS
Sample Data RB/ELT/SH/Sac/CDF Priority Target Damage Per Second
Count 9999
Mean 433997.70
Minimum 382703.41
Maximum 508544.58
Spread ( max - min ) 125841.18
Range [ ( max - min ) / 2 * 100% ] 14.50%
Standard Deviation 18111.8522
5th Percentile 405702.14
95th Percentile 465040.35
( 95th Percentile - 5th Percentile ) 59338.21
Mean Distribution
Standard Deviation 181.1276
95.00% Confidence Intervall ( 433642.70 - 434352.71 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 67
0.1% Error 6691
0.1 Scale Factor Error with Delta=300 2800332
0.05 Scale Factor Error with Delta=300 11201325
0.01 Scale Factor Error with Delta=300 280033120
DPS(e)
Sample Data RB/ELT/SH/Sac/CDF Damage Per Second (Effective)
Count 9999
Mean 846501.89
Minimum 709370.07
Maximum 1001060.85
Spread ( max - min ) 291690.78
Range [ ( max - min ) / 2 * 100% ] 17.23%
Damage
Sample Data RB/ELT/SH/Sac/CDF Damage
Count 9999
Mean 221391579.77
Minimum 151352300.44
Maximum 298429903.89
Spread ( max - min ) 147077603.45
Range [ ( max - min ) / 2 * 100% ] 33.22%
DTPS
Sample Data RB/ELT/SH/Sac/CDF Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data RB/ELT/SH/Sac/CDF Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data RB/ELT/SH/Sac/CDF Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data RB/ELT/SH/Sac/CDF Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data RB/ELT/SH/Sac/CDF Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data RB/ELT/SH/Sac/CDF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RB/ELT/SH/Sac/CDFTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data RB/ELT/SH/Sac/CDF Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 10.80 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 11.25 immolate,if=remains<=tick_time
F 71.66 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 10.09 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
0.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
I 18.37 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
J 30.16 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
K 12.62 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
L 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
M 0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
N 1.04 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.90 soul_harvest
P 21.88 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
Q 6.71 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
R 8.21 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
S 36.91 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
T 4.17 incinerate
U 0.53 life_tap

Sample Sequence

012689ABDEGHIJJLOPJRRSCFSJPFSSJSFFFFFEFKPSGISJJCFPSSSJSJSRFFFFFFKEPCSGISJFPSJJKSFFFFFFPCEGIRSKPISSJFJFFFFFEPKCGISSJPSJFOSJJSKPFEFFFFQCPGIRSKQIPQJFFQJFFFFEPCGIKRSHSINJFPSJJSFFFEFFFKCPGISJJFFPSSKCRSPEIQJFFSJPKCSSEOTGIJFFFFFPQJFFCFKSSIIPEFFGIIRPFFFFFFIIKCFFP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask RB/ELT/SH/Sac/CDF 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food RB/ELT/SH/Sac/CDF 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation RB/ELT/SH/Sac/CDF 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 8 grimoire_of_sacrifice Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
0:00.000 precombat 9 life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
0:00.000 precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 default D dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.103 default E immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.976 default G immolate Fluffy_Pillow 1034075.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.847 default H berserking Fluffy_Pillow 984611.2/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:02.847 default I conflagrate Fluffy_Pillow 984611.2/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.600 default J conflagrate Fluffy_Pillow 1001292.7/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:04.354 default J conflagrate Fluffy_Pillow 1017996.3/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:05.108 default L summon_infernal Fluffy_Pillow 1034700.0/1100000: 94% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:05.862 default O soul_harvest Fluffy_Pillow 1051403.6/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:05.862 default P channel_demonfire Fluffy_Pillow 1051403.6/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:07.608 default J conflagrate Fluffy_Pillow 1037283.4/1100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:08.363 default R dimensional_rift Fluffy_Pillow 1054009.2/1100000: 96% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:09.116 default R dimensional_rift Fluffy_Pillow 1070690.7/1100000: 97% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:09.871 default S chaos_bolt Fluffy_Pillow 1087416.6/1100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:10.856 default C havoc Fluffy_Pillow_Beast1 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:11.609 default F immolate Fluffy_Pillow_Beast1 1028689.9/1100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:12.378 default S chaos_bolt Fluffy_Pillow 979608.2/1100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:13.176 default J conflagrate Fluffy_Pillow 995849.5/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:13.931 default P channel_demonfire Fluffy_Pillow 1009970.7/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:15.305 default F immolate Fluffy_Pillow_Pack_Beast1 982869.5/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:16.050 default S chaos_bolt Fluffy_Pillow 930980.9/1100000: 85% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:16.803 default S chaos_bolt Fluffy_Pillow 945275.5/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:17.557 default J conflagrate Fluffy_Pillow 959589.1/1100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:18.312 default S chaos_bolt Fluffy_Pillow 973921.7/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
0:19.546 default F immolate Fluffy_Pillow_Pack_Beast2 997347.3/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
0:20.575 default F immolate Fluffy_Pillow_Pack_Beast3 950881.4/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
0:21.603 default F immolate Fluffy_Pillow_Pack_Beast4 904396.5/1100000: 82% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
0:22.631 default F immolate Fluffy_Pillow_Pack_Beast5 857911.6/1100000: 78% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
0:23.659 default F immolate Fluffy_Pillow_Pack_Beast6 811426.6/1100000: 74% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, devils_due, accelerando, potion_of_deadly_grace
0:24.687 default E immolate Fluffy_Pillow 764941.7/1100000: 70% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, devils_due, accelerando, potion_of_deadly_grace
0:25.715 default F immolate Fluffy_Pillow_Heavy_Spear2 718456.8/1100000: 65% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, devils_due, accelerando, potion_of_deadly_grace
0:26.744 default K life_tap Fluffy_Pillow 672130.7/1100000: 61% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:27.610 default P channel_demonfire Fluffy_Pillow 1018705.0/1100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, potion_of_deadly_grace
0:29.544 default S chaos_bolt Fluffy_Pillow 1002193.5/1100000: 91% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando, potion_of_deadly_grace
0:31.287 default G immolate Fluffy_Pillow 1035281.8/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:32.159 default I conflagrate Fluffy_Pillow 985835.4/1100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:33.033 default S chaos_bolt Fluffy_Pillow 1002427.0/1100000: 91% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:34.080 default J conflagrate Fluffy_Pillow 1022302.8/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:34.952 default J conflagrate Fluffy_Pillow 1038856.4/1100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:35.826 default C havoc Fluffy_Pillow_Heavy_Spear1 1055448.1/1100000: 96% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:36.580 default F immolate Fluffy_Pillow_Heavy_Spear2 981761.6/1100000: 89% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:37.333 default P channel_demonfire Fluffy_Pillow 930107.3/1100000: 85% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:38.695 default S chaos_bolt Fluffy_Pillow 903544.6/1100000: 82% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
0:39.824 default S chaos_bolt Fluffy_Pillow 925293.4/1100000: 84% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:40.580 default S chaos_bolt Fluffy_Pillow 939856.9/1100000: 85% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:41.441 default J conflagrate Fluffy_Pillow 952481.9/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:42.199 default S chaos_bolt Fluffy_Pillow 963387.5/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
0:43.107 default J conflagrate Fluffy_Pillow 976452.2/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
0:43.861 default S chaos_bolt Fluffy_Pillow 987462.6/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:44.756 default R dimensional_rift Fluffy_Pillow 1000532.0/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:45.755 default F immolate Fluffy_Pillow_Pack_Beast1 1015120.2/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:46.505 default F immolate Fluffy_Pillow_Pack_Beast2 960149.8/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:47.259 default F immolate Fluffy_Pillow_Pack_Beast3 905322.8/1100000: 82% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
0:48.576 default F immolate Fluffy_Pillow_Pack_Beast4 858838.5/1100000: 78% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
0:49.894 default F immolate Fluffy_Pillow_Pack_Beast5 812376.4/1100000: 74% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
0:51.193 default F immolate Fluffy_Pillow_Pack_Beast6 766095.7/1100000: 70% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
0:52.472 default K life_tap Fluffy_Pillow 719600.5/1100000: 65% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
0:53.734 default E immolate Fluffy_Pillow 1069116.8/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
0:54.995 default P channel_demonfire Fluffy_Pillow 1022617.5/1100000: 93% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(5)
0:57.399 default C havoc Fluffy_Pillow_Heavy_Spear2 1004885.9/1100000: 91% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
0:58.532 default S chaos_bolt Fluffy_Pillow 933430.8/1100000: 85% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:00.795 default G immolate Fluffy_Pillow 966656.6/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:01.911 default I conflagrate Fluffy_Pillow 917193.8/1100000: 83% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:03.029 default S chaos_bolt Fluffy_Pillow 933760.7/1100000: 85% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:04.368 default J conflagrate Fluffy_Pillow 953602.4/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:05.485 default F immolate Fluffy_Pillow_Heavy_Spear1 970154.5/1100000: 88% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:06.604 default P channel_demonfire Fluffy_Pillow 920788.7/1100000: 84% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:08.987 default S chaos_bolt Fluffy_Pillow 902985.4/1100000: 82% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
1:11.284 default J conflagrate Fluffy_Pillow 936033.3/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:12.434 default J conflagrate Fluffy_Pillow 952578.8/1100000: 87% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:13.583 default K life_tap Fluffy_Pillow 969110.0/1100000: 88% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos
1:14.732 default S chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:16.112 default F immolate Fluffy_Pillow_Heavy_Spear1 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:17.245 default F immolate Fluffy_Pillow_Pack_Beast1 1034058.4/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:18.378 default F immolate Fluffy_Pillow_Pack_Beast2 984603.3/1100000: 90% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:19.511 default F immolate Fluffy_Pillow_Pack_Beast3 935148.2/1100000: 85% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:20.644 default F immolate Fluffy_Pillow_Pack_Beast4 885767.7/1100000: 81% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:21.762 default F immolate Fluffy_Pillow_Pack_Beast5 836334.5/1100000: 76% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:22.879 default P channel_demonfire Fluffy_Pillow 786890.9/1100000: 72% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:25.426 default C havoc Fluffy_Pillow_Beast1 772818.6/1100000: 70% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(5)
1:26.496 default E immolate Fluffy_Pillow 701365.6/1100000: 64% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(5)
1:27.566 default G immolate Fluffy_Pillow 651912.7/1100000: 59% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(5)
1:28.703 default I conflagrate Fluffy_Pillow 602465.1/1100000: 55% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
1:29.855 default R dimensional_rift Fluffy_Pillow 619039.4/1100000: 56% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
1:31.151 default S chaos_bolt Fluffy_Pillow 637685.5/1100000: 58% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
1:33.006 default K life_tap Fluffy_Pillow 664374.1/1100000: 60% mana | 5.0/5: 100% soul_shard raid_movement, empowered_life_tap, lord_of_flames
1:34.157 default P channel_demonfire Fluffy_Pillow 1010934.0/1100000: 92% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
1:36.669 default I conflagrate Fluffy_Pillow 994843.9/1100000: 90% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:37.786 default S chaos_bolt Fluffy_Pillow 1011395.9/1100000: 92% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:40.016 default S chaos_bolt Fluffy_Pillow 1044440.8/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:41.356 default J conflagrate Fluffy_Pillow 1064297.3/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:42.474 default F immolate Fluffy_Pillow_Heavy_Spear2 1080864.2/1100000: 98% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:43.590 default J conflagrate Fluffy_Pillow 1031401.5/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:44.708 default F immolate Fluffy_Pillow_Heavy_Spear1 1047968.3/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:45.825 default F immolate Fluffy_Pillow_Pack_Beast1 998520.4/1100000: 91% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:46.965 default F immolate Fluffy_Pillow_Pack_Beast2 949065.1/1100000: 86% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames
1:48.115 default F immolate Fluffy_Pillow_Pack_Beast3 899610.6/1100000: 82% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
1:49.264 default F immolate Fluffy_Pillow_Pack_Beast4 850148.9/1100000: 77% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:50.397 default E immolate Fluffy_Pillow 800693.8/1100000: 73% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:51.530 default P channel_demonfire Fluffy_Pillow 751238.6/1100000: 68% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:54.038 default K life_tap Fluffy_Pillow 735376.6/1100000: 67% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(2)
1:55.155 default C havoc Fluffy_Pillow_Heavy_Spear1 1081928.7/1100000: 98% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:56.273 default G immolate Fluffy_Pillow 1010495.6/1100000: 92% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:57.391 default I conflagrate Fluffy_Pillow 961250.6/1100000: 87% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:58.493 default S chaos_bolt Fluffy_Pillow 977817.7/1100000: 89% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:00.694 default S chaos_bolt Fluffy_Pillow 1011327.3/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:01.997 default J conflagrate Fluffy_Pillow 1030538.0/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:03.129 default P channel_demonfire Fluffy_Pillow 1047068.3/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:05.591 default S chaos_bolt Fluffy_Pillow 1030395.2/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:06.931 default J conflagrate Fluffy_Pillow 1050252.9/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:08.025 default F immolate Fluffy_Pillow_Heavy_Spear2 1066794.1/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:09.113 default O soul_harvest Fluffy_Pillow 1017385.2/1100000: 92% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:09.113 default S chaos_bolt Fluffy_Pillow 1017385.2/1100000: 92% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:10.416 default J conflagrate Fluffy_Pillow 1037255.0/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:11.504 default J conflagrate Fluffy_Pillow 1053846.1/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4)
2:12.573 default S chaos_bolt Fluffy_Pillow 1070377.7/1100000: 97% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
2:13.857 default K life_tap Fluffy_Pillow 1090234.2/1100000: 99% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
2:14.999 default P channel_demonfire Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:17.622 default F immolate Fluffy_Pillow_Heavy_Spear2 1084938.2/1100000: 99% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:18.773 default E immolate Fluffy_Pillow 1034071.9/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos
2:19.923 default F immolate Fluffy_Pillow_Pack_Beast1 984618.3/1100000: 90% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
2:21.056 default F immolate Fluffy_Pillow_Pack_Beast2 935221.4/1100000: 85% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:22.174 default F immolate Fluffy_Pillow_Pack_Beast3 885788.3/1100000: 81% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:23.291 default F immolate Fluffy_Pillow_Pack_Beast4 836343.2/1100000: 76% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:24.391 default Q rain_of_fire Fluffy_Pillow 786880.2/1100000: 72% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:25.491 default C havoc Fluffy_Pillow_Beast1 803417.1/1100000: 73% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:26.593 default P channel_demonfire Fluffy_Pillow 731984.2/1100000: 67% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:29.044 default G immolate Fluffy_Pillow 716031.6/1100000: 65% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:30.146 default I conflagrate Fluffy_Pillow 666598.7/1100000: 61% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:31.248 default R dimensional_rift Fluffy_Pillow 683165.7/1100000: 62% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
2:32.358 default S chaos_bolt Fluffy_Pillow 699714.0/1100000: 64% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
2:34.656 default K life_tap Fluffy_Pillow 732913.2/1100000: 67% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
2:35.789 default Q rain_of_fire Fluffy_Pillow 1079458.1/1100000: 98% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:36.923 default I conflagrate Fluffy_Pillow 1096017.6/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:38.057 default P channel_demonfire Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:40.501 default Q rain_of_fire Fluffy_Pillow 1082889.0/1100000: 98% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:41.634 default J conflagrate Fluffy_Pillow 1099433.9/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:42.768 default F immolate Fluffy_Pillow_Heavy_Spear2 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:43.900 default F immolate Fluffy_Pillow_Heavy_Spear1 1034045.1/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
2:45.000 default Q rain_of_fire Fluffy_Pillow 984582.1/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
2:46.104 default J conflagrate Fluffy_Pillow 1001124.9/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames
2:47.255 default F immolate Fluffy_Pillow_Pack_Beast1 1017684.8/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
2:48.404 default F immolate Fluffy_Pillow_Pack_Beast2 968216.6/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:49.539 default F immolate Fluffy_Pillow_Pack_Beast3 918790.7/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:50.671 default F immolate Fluffy_Pillow_Pack_Beast5 869321.0/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:51.805 default E immolate Fluffy_Pillow 819880.5/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:52.938 default P channel_demonfire Fluffy_Pillow 770425.4/1100000: 70% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:55.475 default C havoc Fluffy_Pillow_Heavy_Spear1 754672.5/1100000: 69% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:56.609 default G immolate Fluffy_Pillow 683231.9/1100000: 62% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:57.743 default I conflagrate Fluffy_Pillow 633791.4/1100000: 58% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:58.876 default K life_tap Fluffy_Pillow 650336.3/1100000: 59% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:00.008 default R dimensional_rift Fluffy_Pillow 996869.0/1100000: 91% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:01.146 default S chaos_bolt Fluffy_Pillow 1013411.2/1100000: 92% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:03.443 default H berserking Fluffy_Pillow 1046714.6/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:03.443 default S chaos_bolt Fluffy_Pillow 1046714.6/1100000: 95% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:04.628 default I conflagrate Fluffy_Pillow 1066614.5/1100000: 97% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:05.616 default N summon_infernal Fluffy_Pillow 1083206.1/1100000: 98% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:06.600 default J conflagrate Fluffy_Pillow 1099730.5/1100000: 100% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:07.586 default F immolate Fluffy_Pillow_Heavy_Spear2 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:08.573 default P channel_demonfire Fluffy_Pillow 1034084.0/1100000: 94% mana | 4.0/5: 80% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:10.755 default S chaos_bolt Fluffy_Pillow 1017926.6/1100000: 93% mana | 5.0/5: 100% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando
3:12.724 default J conflagrate Fluffy_Pillow 1051007.4/1100000: 96% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:13.733 default J conflagrate Fluffy_Pillow 1067557.2/1100000: 97% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:14.868 default S chaos_bolt Fluffy_Pillow 1084112.3/1100000: 99% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:16.248 default F immolate Fluffy_Pillow_Heavy_Spear2 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:17.380 default F immolate Fluffy_Pillow_Pack_Beast1 1034043.8/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:18.514 default F immolate Fluffy_Pillow_Pack_Beast2 984604.4/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:19.632 default E immolate Fluffy_Pillow 935268.6/1100000: 85% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:20.734 default F immolate Fluffy_Pillow_Pack_Beast3 885835.6/1100000: 81% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:21.836 default F immolate Fluffy_Pillow_Pack_Beast4 836402.7/1100000: 76% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:22.937 default F immolate Fluffy_Pillow_Pack_Beast5 786954.7/1100000: 72% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:24.039 default K life_tap Fluffy_Pillow 737521.8/1100000: 67% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
3:25.141 default C havoc Fluffy_Pillow_Heavy_Spear2 1084088.8/1100000: 99% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:26.231 default P channel_demonfire Fluffy_Pillow 1012627.0/1100000: 92% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:28.568 default G immolate Fluffy_Pillow 995555.6/1100000: 91% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:29.717 default I conflagrate Fluffy_Pillow 946086.7/1100000: 86% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:30.868 default S chaos_bolt Fluffy_Pillow 962646.6/1100000: 88% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:33.164 default J conflagrate Fluffy_Pillow 995898.7/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:34.299 default J conflagrate Fluffy_Pillow 1012472.8/1100000: 92% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:35.435 default F immolate Fluffy_Pillow_Heavy_Spear1 1029061.4/1100000: 94% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:36.568 default F immolate Fluffy_Pillow_Heavy_Spear2 979606.3/1100000: 89% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:37.702 default P channel_demonfire Fluffy_Pillow 930165.8/1100000: 85% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:40.177 default S chaos_bolt Fluffy_Pillow 913507.5/1100000: 83% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:42.442 default S chaos_bolt Fluffy_Pillow 946582.7/1100000: 86% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:43.802 default K life_tap Fluffy_Pillow 966513.3/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:44.936 default C havoc Fluffy_Pillow_Heavy_Spear1 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:46.274 default R dimensional_rift Fluffy_Pillow 1028544.9/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:47.390 default S chaos_bolt Fluffy_Pillow 1045082.1/1100000: 95% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:48.729 default P channel_demonfire Fluffy_Pillow 1065111.2/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:51.380 default E immolate Fluffy_Pillow 1052165.3/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:52.482 default I conflagrate Fluffy_Pillow 1002732.4/1100000: 91% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:53.582 default Q rain_of_fire Fluffy_Pillow 1019269.4/1100000: 93% mana | 5.0/5: 100% soul_shard raid_movement, empowered_life_tap, lord_of_flames, accelerando(3)
3:54.667 default J conflagrate Fluffy_Pillow 1035814.8/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
3:55.754 default F immolate Fluffy_Pillow_Heavy_Spear2 1052390.7/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:56.840 default F immolate Fluffy_Pillow_Heavy_Spear1 1002951.3/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:57.972 default S chaos_bolt Fluffy_Pillow 953497.3/1100000: 87% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:00.268 default J conflagrate Fluffy_Pillow 986530.8/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:01.420 default P channel_demonfire Fluffy_Pillow 1003105.1/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:03.891 default K life_tap Fluffy_Pillow 986192.1/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:05.027 default C havoc Fluffy_Pillow_Heavy_Spear2 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:06.274 default S chaos_bolt Fluffy_Pillow 1028544.9/1100000: 94% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:08.539 default S chaos_bolt Fluffy_Pillow 1061620.0/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:09.897 default E immolate Fluffy_Pillow 1081450.5/1100000: 98% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:11.030 default O soul_harvest Fluffy_Pillow 1031995.4/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:11.030 default T incinerate Fluffy_Pillow 1031995.4/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:12.390 default G immolate Fluffy_Pillow 985855.1/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:13.522 default I conflagrate Fluffy_Pillow 936385.4/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:14.660 default J conflagrate Fluffy_Pillow 952932.7/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos
4:15.789 default F immolate Fluffy_Pillow_Heavy_Spear1 969453.0/1100000: 88% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:16.908 default F immolate Fluffy_Pillow_Pack_Beast1 920034.7/1100000: 84% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:18.026 default F immolate Fluffy_Pillow_Pack_Beast2 870601.6/1100000: 79% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:19.142 default F immolate Fluffy_Pillow_Pack_Beast3 821138.8/1100000: 75% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2)
4:19.895 default F immolate Fluffy_Pillow_Pack_Beast4 766297.0/1100000: 70% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2)
4:20.649 default P channel_demonfire Fluffy_Pillow 711470.0/1100000: 65% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2)
4:22.400 default Q rain_of_fire Fluffy_Pillow 684793.5/1100000: 62% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3)
4:23.155 default J conflagrate Fluffy_Pillow 696143.8/1100000: 63% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3)
4:23.910 default F immolate Fluffy_Pillow_Pack_Beast5 707494.2/1100000: 64% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:24.664 default F immolate Fluffy_Pillow_Pack_Beast6 652829.6/1100000: 59% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:25.420 default C havoc Fluffy_Pillow_Heavy_Spear2 664195.0/1100000: 60% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:26.164 default F immolate Fluffy_Pillow_Heavy_Spear2 587540.4/1100000: 53% mana | 5.0/5: 100% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
4:26.933 default K life_tap Fluffy_Pillow 533031.8/1100000: 48% mana | 5.0/5: 100% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact
4:27.691 default S chaos_bolt Fluffy_Pillow 873937.5/1100000: 79% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact
4:29.204 default S chaos_bolt Fluffy_Pillow 895882.6/1100000: 81% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:30.100 default I conflagrate Fluffy_Pillow 908966.6/1100000: 83% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:30.854 default I conflagrate Fluffy_Pillow 919977.1/1100000: 84% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:31.598 default P channel_demonfire Fluffy_Pillow 931001.9/1100000: 85% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
4:34.624 default E immolate Fluffy_Pillow 923932.2/1100000: 84% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
4:35.902 default F immolate Fluffy_Pillow_Heavy_Spear2 877421.6/1100000: 80% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
4:37.164 default F immolate Fluffy_Pillow_Heavy_Spear1 830937.9/1100000: 76% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
4:38.425 default G immolate Fluffy_Pillow 784438.6/1100000: 71% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
4:39.687 default I conflagrate Fluffy_Pillow 737954.9/1100000: 67% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(5)
4:40.785 default I conflagrate Fluffy_Pillow 754500.9/1100000: 69% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:41.935 default R dimensional_rift Fluffy_Pillow 771046.4/1100000: 70% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:43.084 default P channel_demonfire Fluffy_Pillow 787577.5/1100000: 72% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:45.595 default F immolate Fluffy_Pillow_Pack_Beast1 770904.3/1100000: 70% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:46.743 default F immolate Fluffy_Pillow_Pack_Beast2 721421.1/1100000: 66% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:47.893 default F immolate Fluffy_Pillow_Pack_Beast3 671966.6/1100000: 61% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos
4:49.045 default F immolate Fluffy_Pillow_Pack_Beast4 622670.1/1100000: 57% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:50.179 default F immolate Fluffy_Pillow_Pack_Beast6 573229.6/1100000: 52% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:51.313 default F immolate Fluffy_Pillow_Pack_Beast5 523789.0/1100000: 48% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:52.447 default I conflagrate Fluffy_Pillow 474348.5/1100000: 43% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:53.583 default I conflagrate Fluffy_Pillow 490937.2/1100000: 45% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando
4:54.718 default K life_tap Fluffy_Pillow 507511.3/1100000: 46% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:55.852 default C havoc Fluffy_Pillow_Heavy_Spear2 854070.8/1100000: 78% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:56.985 default F immolate Fluffy_Pillow_Heavy_Spear2 782615.7/1100000: 71% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:58.120 default F immolate Fluffy_Pillow_Heavy_Spear1 733191.0/1100000: 67% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:59.237 default P channel_demonfire Fluffy_Pillow 683743.1/1100000: 62% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51868 51868 33640
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3112080 3112080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 13.94% 13.94% 3577
Haste 30.79% 29.79% 11173
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14387 14277 0
Mastery 67.65% 67.65% 5819
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 905.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="RB/ELT/SH/Sac/CDF"
level=110
race=troll
role=spell
position=back
talents=2303032
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=904.60
# gear_stamina=33640
# gear_intellect=38456
# gear_crit_rating=3577
# gear_haste_rating=11173
# gear_mastery_rating=5819
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

RB/ELT/SH/Sac/SC : 834493 dps, 451362 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
834492.8 834492.8 778.9 / 0.093% 155167.0 / 18.6% 25.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
28227.7 28227.7 Mana 0.00% 54.5 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Sacrifice
  • 100: Soul Conduit
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
RB/ELT/SH/Sac/SC 834493
Chaos Bolt 183038 22.0% 55.9 5.22sec 983491 687660 Direct 70.2 0 783244 783244 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.92 70.21 0.00 0.00 1.4302 0.0000 54992889.40 54992889.40 0.00 687660.39 687660.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 70.21 100.00% 783243.82 511940 1132775 783590.82 728175 849633 54992889 54992889 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 67446 8.1% 48.7 6.17sec 415592 409261 Direct 61.5 194498 436827 329147 55.6%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.67 61.46 0.00 0.00 1.0155 0.0000 20227738.53 20227738.53 0.00 409261.28 409261.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.31 44.44% 194497.74 129238 285989 194541.38 169447 220145 5311434 5311434 0.00
crit 34.15 55.56% 436826.56 258473 651725 436901.82 389475 490693 14916304 14916304 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 8150 1.0% 20.3 1.48sec 118542 0 Direct 20.0 105431 211176 120117 13.9%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.28 20.02 0.00 0.00 0.0000 0.0000 2404240.49 2404240.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.24 86.11% 105431.32 87244 115162 105428.26 97713 112420 1817240 1817240 0.00
crit 2.78 13.89% 211176.45 174488 230324 199175.96 0 230324 587001 587001 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Demonic Power 122499 14.7% 140.6 2.13sec 261648 0 Direct 461.9 69883 139762 79624 13.9%  

Stats details: demonic_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.55 461.87 0.00 0.00 0.0000 0.0000 36775688.35 36775688.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 397.48 86.06% 69882.77 61705 81451 69875.25 66789 73087 27777151 27777151 0.00
crit 64.38 13.94% 139761.85 123410 162902 139748.80 131578 148700 8998538 8998538 0.00
 
 

Action details: demonic_power

Static Values
  • id:196100
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196100
  • name:Demonic Power
  • school:shadow
  • tooltip:
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 266804 32.0% 101.5 2.92sec 789199 753228 Direct 110.3 134717 269556 196687 46.0%  
Periodic 383.1 104560 209033 152531 45.9% 254.3%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.53 110.29 383.11 383.11 1.0478 1.9961 80129117.42 80129117.42 0.00 91985.28 753227.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.60 54.04% 134717.48 89660 198414 134709.23 122903 146602 8029394 8029394 0.00
crit 50.69 45.96% 269556.16 179324 396826 269546.75 242513 296043 13662976 13662976 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 207.2 54.08% 104559.53 75 409969 104674.24 91005 118854 21664795 21664795 0.00
crit 175.9 45.92% 209032.79 191 819882 209262.28 181778 241470 36771953 36771953 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 14109 1.7% 12.7 20.66sec 333176 292235 Direct 16.7 222076 445105 253096 13.9%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.70 16.71 0.00 0.00 1.1401 0.0000 4230096.54 4230096.54 0.00 292234.65 292234.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.39 86.09% 222076.27 144944 320726 222459.16 177009 287108 3195328 3195328 0.00
crit 2.32 13.91% 445105.33 291536 641418 389455.83 0 641418 1034768 1034768 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9449 1.1% 20.1 14.93sec 141237 0 Direct 20.1 124048 247989 141235 13.9%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.10 20.10 0.00 0.00 0.0000 0.0000 2839198.93 2839198.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.31 86.13% 124048.42 109698 144802 124051.11 116679 134076 2147854 2147854 0.00
crit 2.79 13.87% 247989.10 219396 289603 232645.16 0 289603 691345 691345 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Rain of Fire 52042 6.2% 11.4 20.19sec 1370386 1348853 Periodic 290.7 47040 94072 53613 14.0% 0.0%

Stats details: rain_of_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.37 0.00 0.00 290.71 1.0160 0.0000 15586001.11 15586001.11 0.00 1348853.41 1348853.41
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 250.1 86.02% 47039.54 31659 70060 47031.26 42275 55763 11763578 11763578 0.00
crit 40.6 13.98% 94071.52 63319 140117 94058.41 78414 112999 3822423 3822423 0.00
 
 

Action details: rain_of_fire

Static Values
  • id:5740
  • school:fire
  • resource:soul_shard
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
Spelldata
  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.
 
pet - infernal 157178 / 26685
Immolation 137323 2.8% 2.0 181.36sec 3364177 0 Periodic 161.8 37317 74599 42510 13.9% 16.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 39.37 161.83 0.0000 1.2335 6879421.38 6879421.38 0.00 141648.06 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 139.3 86.07% 37316.82 34281 41137 37322.55 36470 39603 5197738 5197738 0.00
crit 22.5 13.93% 74598.88 68561 82274 74613.78 69616 81417 1681683 1681683 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 19856 0.4% 39.4 5.47sec 25265 20483 Direct 39.4 22171 44345 25265 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.37 39.37 0.00 0.00 1.2335 0.0000 994792.66 1462439.43 31.98 20482.89 20482.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.88 86.05% 22170.87 20500 24600 22171.39 21490 23635 751136 1104240 31.98
crit 5.49 13.95% 44345.21 41000 49200 44210.06 0 49200 243657 358199 31.88
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 85449 / 7793
Doom Bolt 85449 0.8% 9.8 2.24sec 195391 89481 Direct 9.8 181506 362007 195391 7.7%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.75 9.75 0.00 0.00 2.1836 0.0000 1905059.38 1905059.38 0.00 89481.42 89481.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.00 92.31% 181506.05 181003 217204 185528.35 181003 217204 1633554 1633554 0.00
crit 0.75 7.69% 362006.53 362007 362007 226254.08 0 362007 271505 271505 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 196600 / 16662
Immolation 172750 1.7% 1.0 0.00sec 4318915 0 Periodic 96.3 39377 78755 44869 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.31 96.26 0.0000 1.0893 4318914.77 4318914.77 0.00 177740.43 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.8 86.05% 39377.15 34281 41137 39390.55 38028 40385 3261619 3261619 0.00
crit 13.4 13.95% 78754.51 68561 82274 78778.48 71609 82274 1057296 1057296 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23850 0.2% 22.3 1.09sec 26729 24539 Direct 22.3 23442 46878 26729 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.31 22.31 0.00 0.00 1.0893 0.0000 596269.64 876572.85 31.98 24538.85 24538.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.18 85.98% 23442.27 20500 24600 23443.39 22550 24344 449617 660980 31.98
crit 3.13 14.02% 46878.31 41000 49200 45130.61 0 49200 146652 215593 30.78
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 196605 / 16663
Immolation 172793 1.7% 1.0 0.00sec 4319986 0 Periodic 96.3 39376 78772 44881 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.31 96.26 0.0000 1.0893 4319986.49 4319986.49 0.00 177784.54 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.8 86.03% 39375.76 34281 41137 39389.26 38040 40405 3260547 3260547 0.00
crit 13.4 13.97% 78771.60 68561 82274 78793.06 72675 82274 1059439 1059439 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23813 0.2% 22.3 1.09sec 26687 24500 Direct 22.3 23444 46859 26687 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.31 22.31 0.00 0.00 1.0893 0.0000 595337.62 875202.69 31.98 24500.50 24500.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.22 86.15% 23443.83 20500 24600 23444.81 22806 24327 450549 662350 31.98
crit 3.09 13.85% 46858.83 41000 49200 45132.80 0 49200 144788 212853 30.81
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 196534 / 16657
Immolation 172705 1.7% 1.0 0.00sec 4317799 0 Periodic 96.3 39376 78771 44858 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.31 96.26 0.0000 1.0893 4317799.16 4317799.16 0.00 177694.52 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.9 86.08% 39375.84 34281 41137 39389.02 38014 40306 3262735 3262735 0.00
crit 13.4 13.92% 78770.71 68561 82274 78792.08 68561 82274 1055064 1055064 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23829 0.2% 22.3 1.09sec 26706 24518 Direct 22.3 23444 46862 26705 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.31 22.31 0.00 0.00 1.0893 0.0000 595757.50 875819.95 31.98 24517.78 24517.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.20 86.07% 23443.61 20500 24600 23444.80 22687 24344 450129 661733 31.98
crit 3.11 13.93% 46861.76 41000 49200 45270.04 0 49200 145628 214087 30.90
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 113668 / 14850
Shadow Bolt 113668 1.8% 3.3 80.27sec 1346883 0 Periodic 36.3 107349 214299 122157 13.8% 14.9%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.29 0.00 36.31 36.31 0.0000 1.2327 4436112.11 4436112.11 0.00 99097.78 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.3 86.15% 107348.83 109 126576 106983.33 0 126576 3358480 3358480 0.00
crit 5.0 13.85% 214298.87 219 253152 207077.06 0 253152 1077632 1077632 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 132684 / 6980
Chaos Bolt 132684 0.8% 3.3 74.97sec 632517 305563 Direct 3.3 0 632512 632512 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.30 3.30 0.00 0.00 2.0703 0.0000 2089440.11 2089440.11 0.00 305563.05 305563.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.30 100.00% 632511.66 600929 721115 632258.74 0 721115 2089440 2089440 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 232855 / 13200
Chaos Barrage 232855 1.6% 3.3 80.17sec 1191042 0 Periodic 113.7 30415 60840 34649 13.9% 6.0%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 0.00 113.74 113.74 0.0000 0.1584 3941061.63 3941061.63 0.00 218814.15 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.9 86.08% 30414.87 152 34809 30315.91 27711 34809 2977961 2977961 0.00
crit 15.8 13.92% 60840.19 304 69619 60592.82 0 69619 963100 963100 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
RB/ELT/SH/Sac/SC
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Sac/SC
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.70sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 9.7 35.82sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.72 0.00 0.00 0.00 0.9995 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Sac/SC
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Sac/SC
  • harmful:false
  • if_expr:
 
Grimoire of Sacrifice 1.0 0.00sec

Stats details: grimoire_of_sacrifice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_of_sacrifice

Static Values
  • id:108503
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_sacrifice.enabled
Spelldata
  • id:108503
  • name:Grimoire of Sacrifice
  • school:shadow
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.
 
Havoc 10.8 28.18sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.81 0.00 0.00 0.00 1.0374 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 14.3 21.50sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.34 0.00 0.00 0.00 0.9845 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 2.9 121.23sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 2.0 181.36sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.05 0.00 0.00 0.00 0.8578 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.51% 78.51% 1.6(1.6) 19.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.62%
  • accelerando_2:24.38%
  • accelerando_3:14.62%
  • accelerando_4:6.68%
  • accelerando_5:3.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.86% 7.36% 0.0(0.0) 2.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 12.83% 0.0(0.0) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.3 0.0 12.3sec 12.3sec 49.57% 48.25% 0.0(0.0) 0.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.57%

Trigger Attempt Success

  • trigger_pct:49.99%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.3sec 69.3sec 8.71% 8.71% 0.0(0.0) 3.2

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.71%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 21.2 35.7 14.4sec 5.2sec 50.95% 71.07% 35.7(35.7) 20.7

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:50.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 8.9 5.4 34.7sec 21.5sec 91.40% 88.07% 50.3(50.3) 8.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:91.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 98.34% 50.80% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:98.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.7sec 68.8sec 13.57% 13.57% 0.0(0.0) 3.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.57%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.17% 10.17% 0.0(0.0) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 1.5 0.0 86.3sec 86.3sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.40%
Soul Harvest 2.9 0.0 121.2sec 121.2sec 18.00% 18.00% 0.0(0.0) 2.7

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:18.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Demonic Power

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • demonic_power_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196099
  • name:Demonic Power
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.2 75.7sec
chaos_tear 3.3 75.8sec
chaos_portal 3.2 75.8sec
dimension_ripper 0.6 100.9sec
soul_conduit 30.0 10.9sec

Resources

Resource Usage Type Count Total Average RPE APR
RB/ELT/SH/Sac/SC
chaos_bolt Soul Shard 56.9 113.8 2.0 2.0 483119.1
havoc Mana 10.8 951179.4 88000.0 88001.4 0.0
immolate Mana 101.5 6701226.8 66000.0 66001.0 12.0
incinerate Mana 12.7 837902.4 66000.0 65996.0 5.0
rain_of_fire Soul Shard 11.4 34.1 3.0 3.0 456777.3
summon_doomguard Soul Shard 0.0 0.0 1.0 1.0 0.0
summon_infernal Soul Shard 2.0 2.0 1.0 1.0 0.0
pet - doomguard
doom_bolt Energy 0.0 0.3 35.0 0.0 6980333.0
Resource Gains Type Count Total Average Overflow
life_tap Mana 14.34 3860497.67 (47.18%) 269134.94 873054.26 18.44%
immolate Soul Shard 83.77 65.63 (43.71%) 0.78 18.14 21.65%
conflagrate Soul Shard 48.67 46.09 (30.70%) 0.95 2.58 5.30%
mp5_regen Mana 612.05 4322269.38 (52.82%) 7061.93 342851.72 7.35%
soul_conduit Soul Shard 29.99 29.99 (19.97%) 1.00 0.00 0.00%
soulsnatcher Soul Shard 8.53 8.44 (5.62%) 0.99 0.09 1.10%
pet - doomguard
energy_regen Energy 0.01 0.24 (100.00%) 31.40 0.03 11.98%
Resource RPS-Gain RPS-Loss
Health 0.00 14841.59
Mana 27205.33 28227.72
Soul Shard 0.50 0.50
Combat End Resource Mean Min Max
Mana 791362.19 73336.34 1100000.00
Soul Shard 3.18 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.7%

Statistics & Data Analysis

Fight Length
Sample Data RB/ELT/SH/Sac/SC Fight Length
Count 9999
Mean 300.78
Minimum 214.57
Maximum 375.75
Spread ( max - min ) 161.18
Range [ ( max - min ) / 2 * 100% ] 26.79%
DPS
Sample Data RB/ELT/SH/Sac/SC Damage Per Second
Count 9999
Mean 834492.77
Minimum 721520.38
Maximum 992416.09
Spread ( max - min ) 270895.72
Range [ ( max - min ) / 2 * 100% ] 16.23%
Standard Deviation 39740.7825
5th Percentile 773495.92
95th Percentile 903454.95
( 95th Percentile - 5th Percentile ) 129959.03
Mean Distribution
Standard Deviation 397.4277
95.00% Confidence Intervall ( 833713.82 - 835271.71 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 88
0.1% Error 8713
0.1 Scale Factor Error with Delta=300 13482068
0.05 Scale Factor Error with Delta=300 53928271
0.01 Scale Factor Error with Delta=300 1348206752
Priority Target DPS
Sample Data RB/ELT/SH/Sac/SC Priority Target Damage Per Second
Count 9999
Mean 451362.16
Minimum 397332.64
Maximum 525069.52
Spread ( max - min ) 127736.89
Range [ ( max - min ) / 2 * 100% ] 14.15%
Standard Deviation 18134.1083
5th Percentile 423332.87
95th Percentile 482591.94
( 95th Percentile - 5th Percentile ) 59259.07
Mean Distribution
Standard Deviation 181.3502
95.00% Confidence Intervall ( 451006.72 - 451717.60 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 63
0.1% Error 6201
0.1 Scale Factor Error with Delta=300 2807218
0.05 Scale Factor Error with Delta=300 11228871
0.01 Scale Factor Error with Delta=300 280721761
DPS(e)
Sample Data RB/ELT/SH/Sac/SC Damage Per Second (Effective)
Count 9999
Mean 834492.77
Minimum 721520.38
Maximum 992416.09
Spread ( max - min ) 270895.72
Range [ ( max - min ) / 2 * 100% ] 16.23%
Damage
Sample Data RB/ELT/SH/Sac/SC Damage
Count 9999
Mean 217184970.77
Minimum 150730258.98
Maximum 295374835.19
Spread ( max - min ) 144644576.21
Range [ ( max - min ) / 2 * 100% ] 33.30%
DTPS
Sample Data RB/ELT/SH/Sac/SC Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data RB/ELT/SH/Sac/SC Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data RB/ELT/SH/Sac/SC Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data RB/ELT/SH/Sac/SC Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data RB/ELT/SH/Sac/SC Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data RB/ELT/SH/Sac/SC Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RB/ELT/SH/Sac/SCTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data RB/ELT/SH/Sac/SC Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 10.84 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 11.06 immolate,if=remains<=tick_time
F 81.70 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 10.12 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
0.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
I 15.72 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
J 32.95 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
K 12.85 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
L 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
M 0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
N 1.05 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.91 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
P 11.37 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 8.72 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 56.65 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 12.87 incinerate
T 0.50 life_tap

Sample Sequence

012689ABDEGHIJJLOQQJRRCFRJRSFJSFFFFFFFEKQRRRGIJJRCFRRRJRRRJFFFFFFKEPCQRGIRJFRJRJRKSFFFFFFFEPCSGIJQKRFJFRJRRJFFFFFEFKFCRRRGIJFORRJJRKRFFFFFFFPECQGIRJKRFPJFJPSJFFFFFEFKPCFRQRGHIRJFJNRJRKRFFFFFFFFPRRSCERGIJJKRFFRRRRJFFFFEPQKGCIRRRIRJFFJJORKRFEFFFFFPCRGIIIKQFFIRRRIRFFFFFEFICFFIKR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask RB/ELT/SH/Sac/SC 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food RB/ELT/SH/Sac/SC 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation RB/ELT/SH/Sac/SC 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 8 grimoire_of_sacrifice Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
0:00.000 precombat 9 life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
0:00.000 precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 default D dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.103 default E immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.977 default G immolate Fluffy_Pillow 1034096.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:02.838 default H berserking Fluffy_Pillow 984682.5/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:02.838 default I conflagrate Fluffy_Pillow 984682.5/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.594 default J conflagrate Fluffy_Pillow 1001430.4/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:04.349 default J conflagrate Fluffy_Pillow 1018156.2/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:05.104 default L summon_infernal Fluffy_Pillow 1034882.0/1100000: 94% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:05.848 default O soul_harvest Fluffy_Pillow 1051603.6/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:05.848 default Q dimensional_rift Fluffy_Pillow 1051603.6/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:06.603 default Q dimensional_rift Fluffy_Pillow 1068572.5/1100000: 97% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:07.348 default J conflagrate Fluffy_Pillow 1085556.7/1100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4), potion_of_deadly_grace
0:08.105 default R chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_deadly_grace
0:09.558 default R chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:10.432 default C havoc Fluffy_Pillow_Beast1 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:11.187 default F immolate Fluffy_Pillow_Beast1 1029212.2/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:11.941 default R chaos_bolt Fluffy_Pillow 980401.6/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:12.816 default J conflagrate Fluffy_Pillow 999300.4/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:13.686 default R chaos_bolt Fluffy_Pillow 1015878.7/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:14.732 default S incinerate Fluffy_Pillow 1035736.6/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:15.763 default F immolate Fluffy_Pillow_Pack_Beast1 989597.6/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:16.623 default J conflagrate Fluffy_Pillow 940164.5/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:17.484 default S incinerate Fluffy_Pillow 956750.6/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:18.517 default F immolate Fluffy_Pillow_Pack_Beast2 910650.1/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:19.376 default F immolate Fluffy_Pillow_Pack_Beast3 861197.8/1100000: 78% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:20.236 default F immolate Fluffy_Pillow_Pack_Beast4 811764.6/1100000: 74% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:21.094 default F immolate Fluffy_Pillow_Pack_Beast5 762293.0/1100000: 69% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:21.955 default F immolate Fluffy_Pillow_Pack_Beast6 712879.1/1100000: 65% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:22.817 default F immolate Fluffy_Pillow_Heavy_Spear1 663484.5/1100000: 60% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:23.676 default F immolate Fluffy_Pillow_Heavy_Spear2 614032.2/1100000: 56% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:24.535 default E immolate Fluffy_Pillow 564586.2/1100000: 51% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:25.407 default K life_tap Fluffy_Pillow 515126.0/1100000: 47% mana | 5.0/5: 100% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:26.293 default Q dimensional_rift Fluffy_Pillow 861697.4/1100000: 78% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, potion_of_deadly_grace
0:27.177 default R chaos_bolt Fluffy_Pillow 878239.0/1100000: 80% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando, potion_of_deadly_grace
0:28.919 default R chaos_bolt Fluffy_Pillow 911309.7/1100000: 83% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:29.951 default R chaos_bolt Fluffy_Pillow 931254.0/1100000: 85% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:30.967 default G immolate Fluffy_Pillow 951110.5/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
0:31.816 default I conflagrate Fluffy_Pillow 901703.1/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
0:32.666 default J conflagrate Fluffy_Pillow 918315.2/1100000: 83% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:33.515 default J conflagrate Fluffy_Pillow 934907.8/1100000: 85% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:34.364 default R chaos_bolt Fluffy_Pillow 951500.5/1100000: 87% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:35.381 default C havoc Fluffy_Pillow_Heavy_Spear1 971377.8/1100000: 88% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:36.216 default F immolate Fluffy_Pillow_Heavy_Spear2 899930.9/1100000: 82% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:37.052 default R chaos_bolt Fluffy_Pillow 850504.8/1100000: 77% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
0:38.041 default R chaos_bolt Fluffy_Pillow 870387.6/1100000: 79% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
0:39.029 default R chaos_bolt Fluffy_Pillow 890250.2/1100000: 81% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
0:40.019 default J conflagrate Fluffy_Pillow 908936.3/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:40.904 default R chaos_bolt Fluffy_Pillow 925489.0/1100000: 84% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:42.026 default R chaos_bolt Fluffy_Pillow 941631.7/1100000: 86% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:43.405 default R chaos_bolt Fluffy_Pillow 961471.9/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:44.785 default J conflagrate Fluffy_Pillow 981326.5/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:45.937 default F immolate Fluffy_Pillow_Pack_Beast1 997900.8/1100000: 91% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
0:47.089 default F immolate Fluffy_Pillow_Pack_Beast2 948558.2/1100000: 86% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:48.224 default F immolate Fluffy_Pillow_Pack_Beast3 899132.3/1100000: 82% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:49.358 default F immolate Fluffy_Pillow_Pack_Beast4 849777.2/1100000: 77% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
0:50.475 default F immolate Fluffy_Pillow_Pack_Beast6 800329.3/1100000: 73% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
0:51.592 default F immolate Fluffy_Pillow_Pack_Beast5 750881.3/1100000: 68% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
0:52.707 default K life_tap Fluffy_Pillow 701403.7/1100000: 64% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
0:53.824 default E immolate Fluffy_Pillow 1047955.8/1100000: 95% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
0:54.942 default P rain_of_fire Fluffy_Pillow 998522.7/1100000: 91% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
0:56.061 default C havoc Fluffy_Pillow_Heavy_Spear2 1015104.4/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
0:57.179 default Q dimensional_rift Fluffy_Pillow 943671.3/1100000: 86% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
0:58.296 default R chaos_bolt Fluffy_Pillow 960223.3/1100000: 87% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:00.527 default G immolate Fluffy_Pillow 992740.8/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:01.660 default I conflagrate Fluffy_Pillow 943285.6/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:02.793 default R chaos_bolt Fluffy_Pillow 959830.5/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:04.151 default J conflagrate Fluffy_Pillow 979711.9/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:05.269 default F immolate Fluffy_Pillow_Heavy_Spear1 996278.8/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:06.385 default R chaos_bolt Fluffy_Pillow 946861.7/1100000: 86% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:07.706 default J conflagrate Fluffy_Pillow 966721.1/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:08.808 default R chaos_bolt Fluffy_Pillow 983288.1/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:10.128 default J conflagrate Fluffy_Pillow 1003132.5/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:11.230 default R chaos_bolt Fluffy_Pillow 1019699.6/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:12.552 default K life_tap Fluffy_Pillow 1038826.4/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:13.702 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:15.085 default F immolate Fluffy_Pillow_Heavy_Spear1 1034102.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:16.218 default F immolate Fluffy_Pillow_Pack_Beast1 984647.1/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:17.352 default F immolate Fluffy_Pillow_Pack_Beast2 935206.6/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:18.485 default F immolate Fluffy_Pillow_Pack_Beast3 885751.5/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:19.619 default F immolate Fluffy_Pillow_Pack_Beast4 836311.0/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:20.753 default F immolate Fluffy_Pillow_Pack_Beast5 786870.4/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:21.886 default F immolate Fluffy_Pillow_Pack_Beast6 737415.3/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:23.019 default E immolate Fluffy_Pillow 687960.2/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:24.154 default P rain_of_fire Fluffy_Pillow 638534.3/1100000: 58% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:25.284 default C havoc Fluffy_Pillow_Beast1 655084.5/1100000: 60% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:26.402 default S incinerate Fluffy_Pillow 583651.4/1100000: 53% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:27.742 default G immolate Fluffy_Pillow 537314.6/1100000: 49% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:28.861 default I conflagrate Fluffy_Pillow 487896.3/1100000: 44% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:29.978 default J conflagrate Fluffy_Pillow 504448.4/1100000: 46% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:31.096 default Q dimensional_rift Fluffy_Pillow 521015.3/1100000: 47% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:32.214 default K life_tap Fluffy_Pillow 537582.2/1100000: 49% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:33.332 default R chaos_bolt Fluffy_Pillow 884149.0/1100000: 80% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:35.562 default F immolate Fluffy_Pillow_Heavy_Spear1 917200.1/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:36.664 default J conflagrate Fluffy_Pillow 867767.2/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:37.765 default F immolate Fluffy_Pillow_Heavy_Spear2 884319.2/1100000: 80% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:38.867 default R chaos_bolt Fluffy_Pillow 834886.3/1100000: 76% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:40.189 default J conflagrate Fluffy_Pillow 854197.0/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:41.321 default R chaos_bolt Fluffy_Pillow 870727.3/1100000: 79% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:42.680 default R chaos_bolt Fluffy_Pillow 890572.4/1100000: 81% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:44.041 default J conflagrate Fluffy_Pillow 910446.7/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:45.174 default F immolate Fluffy_Pillow_Pack_Beast1 926991.6/1100000: 84% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:46.309 default F immolate Fluffy_Pillow_Pack_Beast2 877565.7/1100000: 80% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:47.443 default F immolate Fluffy_Pillow_Pack_Beast3 828125.1/1100000: 75% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:48.575 default F immolate Fluffy_Pillow_Pack_Beast4 778655.4/1100000: 71% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:49.707 default F immolate Fluffy_Pillow_Pack_Beast5 729187.9/1100000: 66% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:50.824 default E immolate Fluffy_Pillow 679739.9/1100000: 62% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:51.941 default F immolate Fluffy_Pillow_Pack_Beast6 630294.3/1100000: 57% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:53.083 default K life_tap Fluffy_Pillow 646881.8/1100000: 59% mana | 5.0/5: 100% soul_shard raid_movement, lord_of_flames
1:54.232 default F immolate Fluffy_Pillow_Pack_Beast6 993434.3/1100000: 90% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:55.364 default C havoc Fluffy_Pillow_Heavy_Spear1 1009964.5/1100000: 92% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:56.480 default R chaos_bolt Fluffy_Pillow 938501.8/1100000: 85% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:58.709 default R chaos_bolt Fluffy_Pillow 971544.1/1100000: 88% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:00.032 default R chaos_bolt Fluffy_Pillow 991434.9/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
2:01.334 default G immolate Fluffy_Pillow 1011290.2/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
2:02.405 default I conflagrate Fluffy_Pillow 961852.7/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
2:03.476 default J conflagrate Fluffy_Pillow 978415.3/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
2:04.547 default F immolate Fluffy_Pillow_Heavy_Spear2 994977.8/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
2:05.618 default O soul_harvest Fluffy_Pillow 945540.3/1100000: 86% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(5)
2:05.848 default R chaos_bolt Fluffy_Pillow 949097.1/1100000: 86% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(5)
2:07.986 default R chaos_bolt Fluffy_Pillow 980164.4/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos
2:09.365 default J conflagrate Fluffy_Pillow 1000004.6/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos
2:10.516 default J conflagrate Fluffy_Pillow 1016564.6/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:11.667 default R chaos_bolt Fluffy_Pillow 1033124.5/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:13.047 default K life_tap Fluffy_Pillow 1053227.3/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:14.182 default R chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:15.541 default F immolate Fluffy_Pillow_Heavy_Spear2 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:16.674 default F immolate Fluffy_Pillow_Pack_Beast1 1034058.4/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:17.807 default F immolate Fluffy_Pillow_Pack_Beast2 984603.3/1100000: 90% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:18.940 default F immolate Fluffy_Pillow_Pack_Beast3 935148.2/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:20.076 default F immolate Fluffy_Pillow_Pack_Beast4 885736.9/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
2:21.210 default F immolate Fluffy_Pillow_Pack_Beast5 836296.3/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
2:22.344 default F immolate Fluffy_Pillow_Pack_Beast6 786860.8/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:23.460 default P rain_of_fire Fluffy_Pillow 737398.0/1100000: 67% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:24.597 default E immolate Fluffy_Pillow 753943.5/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos
2:25.748 default C havoc Fluffy_Pillow_Beast1 704503.5/1100000: 64% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos
2:26.898 default Q dimensional_rift Fluffy_Pillow 633049.0/1100000: 58% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
2:28.030 default G immolate Fluffy_Pillow 649579.3/1100000: 59% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:29.164 default I conflagrate Fluffy_Pillow 600138.7/1100000: 55% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:30.297 default R chaos_bolt Fluffy_Pillow 616683.6/1100000: 56% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:32.560 default J conflagrate Fluffy_Pillow 649975.8/1100000: 59% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:33.676 default K life_tap Fluffy_Pillow 666513.0/1100000: 61% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:34.793 default R chaos_bolt Fluffy_Pillow 1013065.1/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:36.133 default F immolate Fluffy_Pillow_Heavy_Spear1 1032921.7/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:37.251 default P rain_of_fire Fluffy_Pillow 983488.5/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:38.365 default J conflagrate Fluffy_Pillow 1000047.0/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:39.492 default F immolate Fluffy_Pillow_Heavy_Spear2 1016606.0/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:40.642 default J conflagrate Fluffy_Pillow 967151.5/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
2:41.792 default P rain_of_fire Fluffy_Pillow 983697.1/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
2:42.941 default S incinerate Fluffy_Pillow 1000228.2/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
2:44.322 default J conflagrate Fluffy_Pillow 954097.2/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
2:45.475 default F immolate Fluffy_Pillow_Pack_Beast1 970685.9/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
2:46.626 default F immolate Fluffy_Pillow_Pack_Beast2 921245.8/1100000: 84% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
2:47.777 default F immolate Fluffy_Pillow_Pack_Beast3 871805.7/1100000: 79% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
2:48.930 default F immolate Fluffy_Pillow_Pack_Beast4 822495.4/1100000: 75% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:50.064 default F immolate Fluffy_Pillow_Pack_Beast5 773054.9/1100000: 70% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:51.197 default E immolate Fluffy_Pillow 723599.8/1100000: 66% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:52.330 default F immolate Fluffy_Pillow_Pack_Beast6 674144.6/1100000: 61% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:53.464 default K life_tap Fluffy_Pillow 624711.0/1100000: 57% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:54.581 default P rain_of_fire Fluffy_Pillow 971263.1/1100000: 88% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:55.699 default C havoc Fluffy_Pillow_Heavy_Spear1 987830.0/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:56.800 default F immolate Fluffy_Pillow_Heavy_Spear1 916382.0/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
2:57.901 default R chaos_bolt Fluffy_Pillow 866934.9/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
3:00.069 default Q dimensional_rift Fluffy_Pillow 900173.9/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
3:01.189 default R chaos_bolt Fluffy_Pillow 916710.0/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:02.569 default G immolate Fluffy_Pillow 936565.7/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:03.703 default H berserking Fluffy_Pillow 887125.2/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:03.703 default I conflagrate Fluffy_Pillow 887125.2/1100000: 81% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:04.687 default R chaos_bolt Fluffy_Pillow 903691.6/1100000: 82% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:05.851 default J conflagrate Fluffy_Pillow 923528.1/1100000: 84% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:06.811 default F immolate Fluffy_Pillow_Heavy_Spear2 940125.2/1100000: 85% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:07.768 default J conflagrate Fluffy_Pillow 890671.2/1100000: 81% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
3:08.712 default N summon_infernal Fluffy_Pillow 907225.8/1100000: 82% mana | 4.0/5: 80% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:09.657 default R chaos_bolt Fluffy_Pillow 923797.9/1100000: 84% mana | 4.0/5: 80% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:10.787 default J conflagrate Fluffy_Pillow 943890.1/1100000: 86% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:11.719 default R chaos_bolt Fluffy_Pillow 960465.0/1100000: 87% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:12.838 default K life_tap Fluffy_Pillow 980365.5/1100000: 89% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:13.778 default R chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:15.060 default F immolate Fluffy_Pillow_Heavy_Spear2 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:15.817 default F immolate Fluffy_Pillow_Pack_Beast1 1034057.5/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:16.575 default F immolate Fluffy_Pillow_Pack_Beast2 978963.2/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:17.333 default F immolate Fluffy_Pillow_Pack_Beast3 923868.9/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:18.089 default F immolate Fluffy_Pillow_Pack_Beast4 868748.3/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:18.842 default F immolate Fluffy_Pillow_Pack_Beast5 813744.2/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:19.596 default F immolate Fluffy_Pillow_Pack_Beast6 758754.6/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:20.351 default F immolate Fluffy_Pillow_Heavy_Spear1 703779.7/1100000: 64% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:21.104 default P rain_of_fire Fluffy_Pillow 648775.5/1100000: 59% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:21.858 default R chaos_bolt Fluffy_Pillow 659786.0/1100000: 60% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:23.346 default R chaos_bolt Fluffy_Pillow 681514.8/1100000: 62% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:24.243 default S incinerate Fluffy_Pillow 694660.3/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:25.126 default C havoc Fluffy_Pillow_Heavy_Spear2 641744.8/1100000: 58% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:25.880 default E immolate Fluffy_Pillow 564917.9/1100000: 51% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:26.632 default R chaos_bolt Fluffy_Pillow 510061.2/1100000: 46% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:27.514 default G immolate Fluffy_Pillow 523131.0/1100000: 48% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:28.831 default I conflagrate Fluffy_Pillow 476646.7/1100000: 43% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:30.149 default J conflagrate Fluffy_Pillow 496146.2/1100000: 45% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:31.502 default J conflagrate Fluffy_Pillow 515612.4/1100000: 47% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
3:32.838 default K life_tap Fluffy_Pillow 535121.6/1100000: 49% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:34.175 default R chaos_bolt Fluffy_Pillow 884645.5/1100000: 80% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:36.841 default F immolate Fluffy_Pillow_Heavy_Spear1 923971.5/1100000: 84% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:37.958 default F immolate Fluffy_Pillow_Heavy_Spear2 874523.6/1100000: 80% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:39.076 default R chaos_bolt Fluffy_Pillow 825090.5/1100000: 75% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:40.415 default R chaos_bolt Fluffy_Pillow 844932.2/1100000: 77% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:41.756 default R chaos_bolt Fluffy_Pillow 864803.6/1100000: 79% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:43.097 default R chaos_bolt Fluffy_Pillow 884674.9/1100000: 80% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:44.435 default J conflagrate Fluffy_Pillow 904099.8/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:45.584 default F immolate Fluffy_Pillow_Pack_Beast1 920630.9/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:46.736 default F immolate Fluffy_Pillow_Pack_Beast2 871403.3/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:47.868 default F immolate Fluffy_Pillow_Pack_Beast3 821933.6/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:49.000 default F immolate Fluffy_Pillow_Pack_Beast4 772463.9/1100000: 70% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:50.132 default E immolate Fluffy_Pillow 722994.2/1100000: 66% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:51.264 default P rain_of_fire Fluffy_Pillow 673547.1/1100000: 61% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:52.379 default Q dimensional_rift Fluffy_Pillow 690069.5/1100000: 63% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:53.496 default K life_tap Fluffy_Pillow 706621.6/1100000: 64% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:54.610 default G immolate Fluffy_Pillow 1053163.2/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:55.711 default C havoc Fluffy_Pillow_Heavy_Spear2 1003716.1/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
3:56.797 default I conflagrate Fluffy_Pillow 932276.7/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
3:57.887 default R chaos_bolt Fluffy_Pillow 948837.2/1100000: 86% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:00.183 default R chaos_bolt Fluffy_Pillow 981870.7/1100000: 89% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:01.564 default R chaos_bolt Fluffy_Pillow 1001739.7/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:02.943 default I conflagrate Fluffy_Pillow 1021580.0/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:04.094 default R chaos_bolt Fluffy_Pillow 1038139.9/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:05.474 default J conflagrate Fluffy_Pillow 1057995.6/1100000: 96% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:06.607 default F immolate Fluffy_Pillow_Heavy_Spear2 1074540.5/1100000: 98% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:07.741 default F immolate Fluffy_Pillow_Heavy_Spear1 1025100.0/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:08.873 default J conflagrate Fluffy_Pillow 975630.2/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:10.007 default J conflagrate Fluffy_Pillow 992189.7/1100000: 90% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:11.306 default O soul_harvest Fluffy_Pillow 1011158.7/1100000: 92% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:11.306 default R chaos_bolt Fluffy_Pillow 1011158.7/1100000: 92% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando
4:13.570 default K life_tap Fluffy_Pillow 1044219.2/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:14.702 default R chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:16.060 default F immolate Fluffy_Pillow_Heavy_Spear1 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:17.178 default E immolate Fluffy_Pillow 1034074.1/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:18.319 default F immolate Fluffy_Pillow_Pack_Beast1 984615.5/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos
4:19.469 default F immolate Fluffy_Pillow_Pack_Beast2 935161.0/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos
4:20.618 default F immolate Fluffy_Pillow_Pack_Beast3 885692.2/1100000: 81% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:21.767 default F immolate Fluffy_Pillow_Pack_Beast4 836223.3/1100000: 76% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:22.919 default F immolate Fluffy_Pillow_Pack_Beast5 786797.6/1100000: 72% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:24.068 default P rain_of_fire Fluffy_Pillow 737328.8/1100000: 67% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:25.219 default C havoc Fluffy_Pillow_Heavy_Spear2 753888.7/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:26.353 default R chaos_bolt Fluffy_Pillow 682448.2/1100000: 62% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando
4:28.617 default G immolate Fluffy_Pillow 715508.7/1100000: 65% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:29.750 default I conflagrate Fluffy_Pillow 666053.6/1100000: 61% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:30.884 default I conflagrate Fluffy_Pillow 682613.1/1100000: 62% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:32.018 default I conflagrate Fluffy_Pillow 699172.6/1100000: 64% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:33.152 default K life_tap Fluffy_Pillow 715732.1/1100000: 65% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:34.286 default Q dimensional_rift Fluffy_Pillow 1062291.5/1100000: 97% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:35.404 default F immolate Fluffy_Pillow_Heavy_Spear1 1078858.4/1100000: 98% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:36.522 default F immolate Fluffy_Pillow_Heavy_Spear2 1029425.3/1100000: 94% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:37.652 default I conflagrate Fluffy_Pillow 979983.4/1100000: 89% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
4:38.802 default R chaos_bolt Fluffy_Pillow 996541.6/1100000: 91% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:41.066 default R chaos_bolt Fluffy_Pillow 1029931.0/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:42.406 default R chaos_bolt Fluffy_Pillow 1049841.8/1100000: 95% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:43.727 default I conflagrate Fluffy_Pillow 1069701.2/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:44.829 default R chaos_bolt Fluffy_Pillow 1086268.3/1100000: 99% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:46.149 default F immolate Fluffy_Pillow_Pack_Beast1 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:47.235 default F immolate Fluffy_Pillow_Pack_Beast2 1034061.0/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:48.320 default F immolate Fluffy_Pillow_Pack_Beast3 984606.4/1100000: 90% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:49.407 default F immolate Fluffy_Pillow_Pack_Beast4 935184.9/1100000: 85% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
4:50.477 default F immolate Fluffy_Pillow_Pack_Beast6 885732.0/1100000: 81% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(5)
4:51.607 default E immolate Fluffy_Pillow 836276.2/1100000: 76% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:52.757 default F immolate Fluffy_Pillow_Pack_Beast5 786821.8/1100000: 72% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:53.908 default I conflagrate Fluffy_Pillow 737381.7/1100000: 67% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos
4:55.058 default C havoc Fluffy_Pillow_Heavy_Spear2 753927.2/1100000: 69% mana | 5.0/5: 100% soul_shard lord_of_flames
4:56.209 default F immolate Fluffy_Pillow_Heavy_Spear2 682487.1/1100000: 62% mana | 5.0/5: 100% soul_shard lord_of_flames
4:57.360 default F immolate Fluffy_Pillow_Heavy_Spear1 633047.0/1100000: 58% mana | 5.0/5: 100% soul_shard lord_of_flames
4:58.510 default I conflagrate Fluffy_Pillow 583592.6/1100000: 53% mana | 5.0/5: 100% soul_shard lord_of_flames
4:59.661 default K life_tap Fluffy_Pillow 600152.5/1100000: 55% mana | 5.0/5: 100% soul_shard lord_of_flames
5:00.811 default R chaos_bolt Fluffy_Pillow 946700.6/1100000: 86% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51868 51868 33640
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3112080 3112080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 13.94% 13.94% 3577
Haste 30.79% 29.79% 11173
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14387 14277 0
Mastery 67.65% 67.65% 5819
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 905.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="RB/ELT/SH/Sac/SC"
level=110
race=troll
role=spell
position=back
talents=2303033
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=904.60
# gear_stamina=33640
# gear_intellect=38456
# gear_crit_rating=3577
# gear_haste_rating=11173
# gear_mastery_rating=5819
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

RB/ELT/SH/Sac/WH : 818822 dps, 420454 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
818822.4 818822.4 800.7 / 0.098% 158709.3 / 19.4% 21.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
33465.5 33465.5 Mana 0.00% 54.0 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Sacrifice
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
RB/ELT/SH/Sac/WH 818822
Chaos Bolt 166518 20.4% 39.5 7.42sec 1266520 810041 Direct 64.1 0 779766 779766 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.47 64.12 0.00 0.00 1.5635 0.0000 49994928.53 49994928.53 0.00 810041.13 810041.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 64.12 100.00% 779765.56 511896 1132769 780020.52 722341 845106 49994929 49994929 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 81066 9.9% 48.1 6.25sec 505716 496007 Direct 74.2 194626 436393 328033 55.2%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.13 74.20 0.00 0.00 1.0196 0.0000 24339084.26 24339084.26 0.00 496007.42 496007.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.25 44.82% 194625.60 129233 285989 194689.14 171886 219724 6471740 6471740 0.00
crit 40.94 55.18% 436393.18 258584 651725 436420.07 387735 481961 17867344 17867344 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 8218 1.0% 20.2 1.48sec 119876 0 Direct 19.9 106830 213508 121713 14.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.23 19.92 0.00 0.00 0.0000 0.0000 2424607.18 2424607.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.14 86.05% 106829.78 87244 115162 106815.66 97713 112603 1831209 1831209 0.00
crit 2.78 13.95% 213507.80 174488 230324 201855.67 0 230324 593398 593398 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Demonic Power 114267 14.0% 139.5 2.15sec 245889 0 Direct 424.8 70861 141703 80732 13.9%  

Stats details: demonic_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 139.46 424.77 0.00 0.00 0.0000 0.0000 34292395.16 34292395.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 365.58 86.07% 70860.67 61705 81451 70858.48 67897 73804 25904868 25904868 0.00
crit 59.19 13.93% 141702.79 123410 162902 141703.23 133384 149635 8387527 8387527 0.00
 
 

Action details: demonic_power

Static Values
  • id:196100
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196100
  • name:Demonic Power
  • school:shadow
  • tooltip:
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 208530 25.5% 61.2 4.87sec 1024008 979554 Direct 77.2 136170 272251 198718 46.0%  
Periodic 276.8 117085 234133 170883 46.0% 182.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.17 77.19 276.79 276.79 1.0454 1.9870 62636620.68 62636620.68 0.00 102027.33 979554.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.71 54.04% 136170.26 89661 198414 136161.85 122490 149775 5679702 5679702 0.00
crit 35.48 45.96% 272251.01 179320 396824 272228.17 242689 300275 9658551 9658551 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 149.6 54.04% 117084.92 57 502219 117351.16 99657 139355 17512660 17512660 0.00
crit 127.2 45.96% 234133.21 107 1019250 234686.88 196459 295542 29785708 29785708 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 45564 5.6% 35.2 7.97sec 389066 327356 Direct 53.6 223929 448053 255171 13.9%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.16 53.62 0.00 0.00 1.1885 0.0000 13681205.37 13681205.37 0.00 327356.38 327356.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.14 86.06% 223928.52 145124 320737 224147.39 203819 250887 10332291 10332291 0.00
crit 7.47 13.94% 448053.25 289896 641474 447982.14 0 638912 3348914 3348914 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9544 1.2% 20.2 14.75sec 141900 0 Direct 20.2 124500 248917 141900 14.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.21 20.21 0.00 0.00 0.0000 0.0000 2867125.39 2867125.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.38 86.01% 124499.67 109698 144802 124497.18 117240 134243 2163742 2163742 0.00
crit 2.83 13.99% 248916.88 219396 289603 234661.33 0 289603 703383 703383 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Rain of Fire 70268 8.6% 8.7 29.76sec 2412290 2299536 Periodic 386.4 47884 95746 54560 13.9% 0.0%

Stats details: rain_of_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.74 0.00 0.00 386.41 1.0491 0.0000 21082143.10 21082143.10 0.00 2299535.68 2299535.68
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 332.5 86.05% 47884.06 31664 70060 47843.90 42258 55988 15921815 15921815 0.00
crit 53.9 13.95% 95746.00 63331 140120 95660.40 78593 118414 5160328 5160328 0.00
 
 

Action details: rain_of_fire

Static Values
  • id:5740
  • school:fire
  • resource:soul_shard
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
Spelldata
  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.
 
pet - infernal 157061 / 26520
Immolation 137225 2.8% 2.0 181.76sec 3361396 0 Periodic 160.8 37343 74688 42536 13.9% 16.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 39.16 160.82 0.0000 1.2341 6840452.70 6840452.70 0.00 141530.51 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.5 86.09% 37342.92 34281 41137 37356.90 36520 39890 5170307 5170307 0.00
crit 22.4 13.91% 74687.83 68561 82274 74718.10 69754 82274 1670146 1670146 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 19836 0.4% 39.2 5.46sec 25257 20466 Direct 39.2 22181 44342 25257 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.16 39.16 0.00 0.00 1.2341 0.0000 989173.47 1454178.70 31.98 20466.22 20466.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.73 86.12% 22181.02 20500 24600 22185.98 21558 23917 748118 1099805 31.98
crit 5.44 13.88% 44342.06 41000 49200 44195.38 0 49200 241055 354374 31.87
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 84409 / 8657
Doom Bolt 84409 0.9% 10.4 2.22sec 203383 92715 Direct 10.4 181003 362007 203383 12.4%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.36 10.36 0.00 0.00 2.1937 0.0000 2106959.37 2106959.37 0.00 92715.48 92715.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.08 87.64% 181003.27 181003 181003 170834.54 0 181003 1643266 1643266 0.00
crit 1.28 12.36% 362006.53 362007 362007 272521.77 0 362007 463694 463694 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 196617 / 16662
Immolation 172824 1.8% 1.0 0.00sec 4320774 0 Periodic 96.3 39393 78772 44877 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.27 96.28 0.0000 1.0901 4320774.34 4320774.34 0.00 178000.10 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.9 86.08% 39393.16 34281 41137 39406.63 38365 40243 3264723 3264723 0.00
crit 13.4 13.92% 78772.18 68561 82274 78806.16 70847 82274 1056052 1056052 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23793 0.2% 22.3 1.09sec 26714 24506 Direct 22.3 23448 46881 26713 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.27 22.27 0.00 0.00 1.0901 0.0000 594857.46 874496.81 31.98 24505.95 24505.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.16 86.06% 23448.37 20500 24600 23449.55 22550 24144 449375 660623 31.98
crit 3.10 13.94% 46881.43 41000 49200 45301.22 0 49200 145483 213874 30.89
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 196569 / 16659
Immolation 172780 1.8% 1.0 0.00sec 4319673 0 Periodic 96.3 39393 78779 44865 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.27 96.28 0.0000 1.0901 4319673.13 4319673.13 0.00 177954.73 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.9 86.11% 39392.58 34281 41137 39406.23 38369 40243 3265824 3265824 0.00
crit 13.4 13.89% 78779.35 68561 82274 78801.42 71304 82274 1053849 1053849 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23789 0.2% 22.3 1.09sec 26710 24502 Direct 22.3 23449 46873 26711 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.27 22.27 0.00 0.00 1.0901 0.0000 594759.87 874353.35 31.98 24501.93 24501.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.17 86.08% 23449.03 20500 24600 23450.26 22687 24327 449472 660767 31.98
crit 3.10 13.92% 46873.25 41000 49200 45303.81 0 49200 145288 213587 30.90
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 196726 / 16672
Immolation 172933 1.8% 1.0 0.00sec 4323499 0 Periodic 96.3 39390 78806 44904 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.27 96.28 0.0000 1.0901 4323498.55 4323498.55 0.00 178112.32 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.8 86.01% 39390.44 34281 41137 39404.14 38394 40385 3261998 3261998 0.00
crit 13.5 13.99% 78805.62 68561 82274 78837.10 70520 82274 1061500 1061500 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23793 0.2% 22.3 1.09sec 26713 24505 Direct 22.3 23448 46881 26714 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.27 22.27 0.00 0.00 1.0901 0.0000 594843.11 874475.71 31.98 24505.36 24505.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.17 86.07% 23448.37 20500 24600 23449.65 22708 24344 449389 660644 31.98
crit 3.10 13.93% 46881.31 41000 49200 45305.05 0 49200 145454 213832 30.89
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 112867 / 16447
Shadow Bolt 112867 2.0% 3.7 72.30sec 1341390 0 Periodic 40.3 106897 213593 121813 14.0% 16.6%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.66 0.00 40.28 40.28 0.0000 1.2425 4906310.38 4906310.38 0.00 98039.93 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.6 86.02% 106896.86 109 126576 106563.61 0 126576 3703777 3703777 0.00
crit 5.6 13.98% 213592.84 222 253152 207620.71 0 253152 1202534 1202534 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 132796 / 7715
Chaos Bolt 132796 0.9% 3.6 70.82sec 633997 304881 Direct 3.6 0 633990 633990 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.64 3.64 0.00 0.00 2.0797 0.0000 2309471.90 2309471.90 0.00 304880.78 304880.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.64 100.00% 633989.57 600929 721115 634098.45 0 721115 2309472 2309472 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 229508 / 14686
Chaos Barrage 229508 1.8% 3.7 71.90sec 1183256 0 Periodic 126.4 30456 60855 34686 13.9% 6.7%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.71 0.00 126.40 126.40 0.0000 0.1598 4384506.42 4384506.42 0.00 217054.77 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.8 86.08% 30456.24 152 34809 30371.29 0 34809 3314056 3314056 0.00
crit 17.6 13.92% 60855.24 304 69619 60637.78 0 69619 1070451 1070451 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
RB/ELT/SH/Sac/WH
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Sac/WH
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.77sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 10.9 31.31sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.86 0.00 0.00 0.00 1.0038 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Sac/WH
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Sac/WH
  • harmful:false
  • if_expr:
 
Grimoire of Sacrifice 1.0 0.00sec

Stats details: grimoire_of_sacrifice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_of_sacrifice

Static Values
  • id:108503
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_sacrifice.enabled
Spelldata
  • id:108503
  • name:Grimoire of Sacrifice
  • school:shadow
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.
 
Havoc 42.1 6.81sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.13 0.00 0.00 0.00 1.0378 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.7 19.77sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.66 0.00 0.00 0.00 0.9715 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 2.9 121.16sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 0.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.01 0.00 0.00 0.00 1.0073 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 2.0 181.76sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.8584 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.3sec 15.3sec 78.57% 78.57% 1.5(1.5) 19.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.74%
  • accelerando_2:24.47%
  • accelerando_3:14.64%
  • accelerando_4:6.65%
  • accelerando_5:3.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.8sec 180.8sec 6.86% 7.72% 0.0(0.0) 2.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 13.34% 0.0(0.0) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.1 0.0 12.4sec 12.4sec 49.20% 47.67% 0.0(0.0) 0.6

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.20%

Trigger Attempt Success

  • trigger_pct:50.04%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.7sec 69.7sec 8.68% 8.68% 0.0(0.0) 3.2

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.68%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 21.5 19.0 14.3sec 7.4sec 42.02% 55.23% 19.0(19.0) 21.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:42.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 6.8 8.8 43.3sec 19.8sec 95.91% 93.87% 51.4(51.4) 5.9

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:95.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 98.30% 51.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:98.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.1sec 69.4sec 13.55% 13.55% 0.0(0.0) 3.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.55%

Trigger Attempt Success

  • trigger_pct:99.91%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.17% 10.17% 0.0(0.0) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 1.5 0.0 86.3sec 86.3sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.50%
Soul Harvest 2.9 0.0 121.1sec 121.1sec 17.92% 17.92% 0.0(0.0) 2.7

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Demonic Power

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • demonic_power_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196099
  • name:Demonic Power
  • tooltip:Your spells sometimes deal additional Shadow damage.
  • description:{$@spelldesc108503=Sacrifice your demon to gain Demonic Power, causing your spells to sometimes also deal {$196100s1=0} Shadow damage to the target and other enemies within $196100A1 yds. Lasts {$196099d=3600 seconds} or until you summon a demon.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.6 69.7sec
chaos_tear 3.6 69.6sec
chaos_portal 3.7 68.7sec
dimension_ripper 1.7 78.7sec

Resources

Resource Usage Type Count Total Average RPE APR
RB/ELT/SH/Sac/WH
chaos_bolt Soul Shard 40.5 80.9 2.0 2.1 617623.1
havoc Mana 42.1 3707656.5 88000.0 87998.8 0.0
immolate Mana 61.2 4037150.7 66000.0 66000.9 15.5
incinerate Mana 35.2 2320827.4 66000.0 65999.7 5.9
rain_of_fire Soul Shard 8.7 26.2 3.0 3.0 804050.2
summon_doomguard Soul Shard 0.0 0.0 1.0 1.0 0.0
summon_infernal Soul Shard 2.0 2.0 1.0 1.0 0.0
pet - doomguard
doom_bolt Energy 0.1 3.2 35.0 0.3 653111.7
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.66 4711897.24 (51.02%) 300943.11 454946.71 8.81%
immolate Soul Shard 60.61 55.35 (51.06%) 0.91 5.26 8.68%
conflagrate Soul Shard 48.13 46.99 (43.35%) 0.98 1.13 2.36%
mp5_regen Mana 545.81 4524336.16 (48.98%) 8289.24 140678.66 3.02%
soulsnatcher Soul Shard 6.06 6.06 (5.59%) 1.00 0.00 0.00%
pet - doomguard
energy_regen Energy 0.09 2.93 (100.00%) 31.80 0.36 10.81%
Resource RPS-Gain RPS-Loss
Health 0.00 16200.16
Mana 30708.01 33465.46
Soul Shard 0.36 0.36
Combat End Resource Mean Min Max
Mana 270801.86 3006.70 899087.20
Soul Shard 2.18 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.3%

Statistics & Data Analysis

Fight Length
Sample Data RB/ELT/SH/Sac/WH Fight Length
Count 9999
Mean 300.78
Minimum 214.57
Maximum 375.75
Spread ( max - min ) 161.18
Range [ ( max - min ) / 2 * 100% ] 26.79%
DPS
Sample Data RB/ELT/SH/Sac/WH Damage Per Second
Count 9999
Mean 818822.40
Minimum 702173.55
Maximum 1040390.67
Spread ( max - min ) 338217.12
Range [ ( max - min ) / 2 * 100% ] 20.65%
Standard Deviation 40852.1021
5th Percentile 756123.51
95th Percentile 889410.35
( 95th Percentile - 5th Percentile ) 133286.84
Mean Distribution
Standard Deviation 408.5414
95.00% Confidence Intervall ( 818021.67 - 819623.12 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 96
0.1% Error 9562
0.1 Scale Factor Error with Delta=300 14246642
0.05 Scale Factor Error with Delta=300 56986565
0.01 Scale Factor Error with Delta=300 1424664120
Priority Target DPS
Sample Data RB/ELT/SH/Sac/WH Priority Target Damage Per Second
Count 9999
Mean 420454.04
Minimum 369862.25
Maximum 499364.62
Spread ( max - min ) 129502.37
Range [ ( max - min ) / 2 * 100% ] 15.40%
Standard Deviation 18160.7297
5th Percentile 392081.54
95th Percentile 452277.51
( 95th Percentile - 5th Percentile ) 60195.97
Mean Distribution
Standard Deviation 181.6164
95.00% Confidence Intervall ( 420098.07 - 420810.00 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 72
0.1% Error 7167
0.1 Scale Factor Error with Delta=300 2815466
0.05 Scale Factor Error with Delta=300 11261864
0.01 Scale Factor Error with Delta=300 281546580
DPS(e)
Sample Data RB/ELT/SH/Sac/WH Damage Per Second (Effective)
Count 9999
Mean 818822.40
Minimum 702173.55
Maximum 1040390.67
Spread ( max - min ) 338217.12
Range [ ( max - min ) / 2 * 100% ] 20.65%
Damage
Sample Data RB/ELT/SH/Sac/WH Damage
Count 9999
Mean 211318109.68
Minimum 147889095.97
Maximum 291319515.87
Spread ( max - min ) 143430419.90
Range [ ( max - min ) / 2 * 100% ] 33.94%
DTPS
Sample Data RB/ELT/SH/Sac/WH Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data RB/ELT/SH/Sac/WH Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data RB/ELT/SH/Sac/WH Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data RB/ELT/SH/Sac/WH Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data RB/ELT/SH/Sac/WH Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data RB/ELT/SH/Sac/WH Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RB/ELT/SH/Sac/WHTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data RB/ELT/SH/Sac/WH Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 42.13 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 11.02 immolate,if=remains<=tick_time
F 43.23 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.28 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
0.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
I 15.82 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
J 32.31 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
K 10.53 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
L 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
M 0.01 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
N 1.04 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.91 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
P 8.74 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 9.86 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 40.12 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 35.65 incinerate
T 4.13 life_tap

Sample Sequence

012689ABDEGHIJJLOQQRJRCFRJRSFJRSSKSSSSSFFCCCCCCEGIRCRIJFFKRQPJPJFFFFECRSGIJKRJJRSRSFFFFFFFPEKCGIRJQRJCCCCCCCCKPIPESSGICJFFRJRJKORJRSQRFEFFFFFQRCGIJKRRJJRSRSCCFJSSEKSQSCRSGIHJJNQRJRKSSQFFFFFFSECRGIJJKRCCCCCCCCCCJRFJQREKRCFSSSGIJFRORJJKRRFFFFFFFRCEGIIIKQCCCCCCIFIPRFTSIRESQSCFTFIS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask RB/ELT/SH/Sac/WH 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food RB/ELT/SH/Sac/WH 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation RB/ELT/SH/Sac/WH 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 8 grimoire_of_sacrifice Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
0:00.000 precombat 9 life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
0:00.000 precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 default D dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.102 default E immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.975 default G immolate Fluffy_Pillow 1034075.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.847 default H berserking Fluffy_Pillow 984629.6/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.847 default I conflagrate Fluffy_Pillow 984629.6/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.606 default J conflagrate Fluffy_Pillow 1001199.4/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:04.354 default J conflagrate Fluffy_Pillow 1017770.1/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:05.107 default L summon_infernal Fluffy_Pillow 1034451.6/1100000: 94% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:05.862 default O soul_harvest Fluffy_Pillow 1051177.4/1100000: 96% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:05.862 default Q dimensional_rift Fluffy_Pillow 1051177.4/1100000: 96% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:06.617 default Q dimensional_rift Fluffy_Pillow 1067903.2/1100000: 97% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:07.373 default R chaos_bolt Fluffy_Pillow 1084651.2/1100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:08.866 default J conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:09.621 default R chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:10.519 default C havoc Fluffy_Pillow_Beast1 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:11.274 default F immolate Fluffy_Pillow_Beast1 1028725.8/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:12.028 default R chaos_bolt Fluffy_Pillow 979414.6/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:12.938 default J conflagrate Fluffy_Pillow 999021.8/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:13.807 default R chaos_bolt Fluffy_Pillow 1015590.0/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:14.838 default S incinerate Fluffy_Pillow 1035450.9/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:15.870 default F immolate Fluffy_Pillow_Pack_Beast1 989331.2/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:16.625 default J conflagrate Fluffy_Pillow 937875.4/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:17.380 default R chaos_bolt Fluffy_Pillow 952419.6/1100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:18.134 default S incinerate Fluffy_Pillow 966944.5/1100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:18.890 default S incinerate Fluffy_Pillow 915507.9/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:19.638 default K life_tap Fluffy_Pillow 864048.6/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_deadly_grace
0:20.393 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_deadly_grace
0:21.148 default S incinerate Fluffy_Pillow 1035962.6/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_deadly_grace
0:21.894 default S incinerate Fluffy_Pillow 984873.9/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5), potion_of_deadly_grace
0:22.651 default S incinerate Fluffy_Pillow 934092.5/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(5), potion_of_deadly_grace
0:23.406 default S incinerate Fluffy_Pillow 883271.0/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(5), potion_of_deadly_grace
0:24.171 default F immolate Fluffy_Pillow_Heavy_Spear2 832436.2/1100000: 76% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, potion_of_deadly_grace
0:24.922 default F immolate Fluffy_Pillow_Pack_Beast2 780546.2/1100000: 71% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:25.676 default C havoc Fluffy_Pillow_Heavy_Spear2 794859.8/1100000: 72% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:26.430 default C havoc Fluffy_Pillow_Heavy_Spear2 721173.3/1100000: 66% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:27.185 default C havoc Fluffy_Pillow_Heavy_Spear2 647505.9/1100000: 59% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:27.940 default C havoc Fluffy_Pillow_Heavy_Spear2 573838.5/1100000: 52% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
0:28.955 default C havoc Fluffy_Pillow_Heavy_Spear2 505391.3/1100000: 46% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2), potion_of_deadly_grace
0:29.968 default C havoc Fluffy_Pillow_Heavy_Spear2 436905.5/1100000: 40% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2), potion_of_deadly_grace
0:30.981 default E immolate Fluffy_Pillow 368419.7/1100000: 33% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
0:31.995 default G immolate Fluffy_Pillow 321953.3/1100000: 29% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
0:33.007 default I conflagrate Fluffy_Pillow 275449.1/1100000: 25% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
0:34.004 default R chaos_bolt Fluffy_Pillow 294934.2/1100000: 27% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
0:35.998 default C havoc Fluffy_Pillow_Heavy_Spear1 333904.3/1100000: 30% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:36.852 default R chaos_bolt Fluffy_Pillow 262462.8/1100000: 24% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:37.915 default I conflagrate Fluffy_Pillow 282344.7/1100000: 26% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:38.802 default J conflagrate Fluffy_Pillow 298934.9/1100000: 27% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:39.688 default F immolate Fluffy_Pillow_Heavy_Spear1 315506.3/1100000: 29% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:40.575 default F immolate Fluffy_Pillow_Heavy_Spear2 266097.8/1100000: 24% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando
0:41.578 default K life_tap Fluffy_Pillow 214823.0/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
0:42.690 default R chaos_bolt Fluffy_Pillow 561377.6/1100000: 51% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
0:44.890 default Q dimensional_rift Fluffy_Pillow 594452.7/1100000: 54% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
0:46.088 default P rain_of_fire Fluffy_Pillow 612721.3/1100000: 56% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
0:47.174 default J conflagrate Fluffy_Pillow 629281.9/1100000: 57% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
0:48.261 default P rain_of_fire Fluffy_Pillow 645857.8/1100000: 59% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
0:49.346 default J conflagrate Fluffy_Pillow 662403.3/1100000: 60% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
0:50.432 default F immolate Fluffy_Pillow_Pack_Beast6 678963.9/1100000: 62% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
0:51.519 default F immolate Fluffy_Pillow_Pack_Beast5 629539.8/1100000: 57% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
0:52.605 default F immolate Fluffy_Pillow_Pack_Beast1 580070.3/1100000: 53% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
0:53.756 default F immolate Fluffy_Pillow_Pack_Beast2 530630.2/1100000: 48% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
0:54.908 default E immolate Fluffy_Pillow 481204.5/1100000: 44% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
0:56.060 default C havoc Fluffy_Pillow_Heavy_Spear2 431780.1/1100000: 39% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
0:57.181 default R chaos_bolt Fluffy_Pillow 360317.3/1100000: 33% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
0:59.413 default S incinerate Fluffy_Pillow 393553.3/1100000: 36% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:00.735 default G immolate Fluffy_Pillow 347427.7/1100000: 32% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:01.837 default I conflagrate Fluffy_Pillow 297994.8/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
1:02.939 default J conflagrate Fluffy_Pillow 314561.8/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:04.039 default K life_tap Fluffy_Pillow 331101.4/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
1:05.125 default R chaos_bolt Fluffy_Pillow 677662.1/1100000: 62% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
1:07.295 default J conflagrate Fluffy_Pillow 710983.9/1100000: 65% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
1:08.390 default J conflagrate Fluffy_Pillow 727555.7/1100000: 66% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:09.600 default R chaos_bolt Fluffy_Pillow 744964.4/1100000: 68% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:10.980 default S incinerate Fluffy_Pillow 764820.1/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:12.338 default R chaos_bolt Fluffy_Pillow 718751.8/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:13.676 default S incinerate Fluffy_Pillow 738578.7/1100000: 67% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:15.015 default F immolate Fluffy_Pillow_Pack_Beast2 692421.0/1100000: 63% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:16.118 default F immolate Fluffy_Pillow_Pack_Beast1 643004.4/1100000: 58% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:17.204 default F immolate Fluffy_Pillow_Pack_Beast3 593565.1/1100000: 54% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:18.290 default F immolate Fluffy_Pillow_Pack_Beast4 544125.8/1100000: 49% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
1:19.375 default F immolate Fluffy_Pillow_Pack_Beast5 494671.2/1100000: 45% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
1:20.462 default F immolate Fluffy_Pillow_Pack_Beast6 445247.1/1100000: 40% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
1:21.548 default F immolate Fluffy_Pillow_Heavy_Spear1 395807.7/1100000: 36% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
1:22.634 default P rain_of_fire Fluffy_Pillow 346368.4/1100000: 31% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
1:23.765 default E immolate Fluffy_Pillow 362934.4/1100000: 33% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:24.916 default K life_tap Fluffy_Pillow 313524.1/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:26.049 default C havoc Fluffy_Pillow_Beast1 660068.9/1100000: 60% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:27.182 default G immolate Fluffy_Pillow 588613.8/1100000: 54% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:28.315 default I conflagrate Fluffy_Pillow 539158.7/1100000: 49% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:29.448 default R chaos_bolt Fluffy_Pillow 555703.6/1100000: 51% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:31.711 default J conflagrate Fluffy_Pillow 588749.5/1100000: 54% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:32.844 default Q dimensional_rift Fluffy_Pillow 605294.4/1100000: 55% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:33.977 default R chaos_bolt Fluffy_Pillow 621839.3/1100000: 57% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:35.336 default J conflagrate Fluffy_Pillow 641684.4/1100000: 58% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:36.467 default C havoc Fluffy_Pillow_Heavy_Spear2 658235.0/1100000: 60% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:37.608 default C havoc Fluffy_Pillow_Heavy_Spear2 586785.1/1100000: 53% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:38.756 default C havoc Fluffy_Pillow_Heavy_Spear2 515343.1/1100000: 47% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:39.887 default C havoc Fluffy_Pillow_Heavy_Spear2 443858.8/1100000: 40% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:41.004 default C havoc Fluffy_Pillow_Heavy_Spear2 372410.9/1100000: 34% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:42.123 default C havoc Fluffy_Pillow_Heavy_Spear2 300992.6/1100000: 27% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:43.241 default C havoc Fluffy_Pillow_Heavy_Spear2 229559.5/1100000: 21% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:44.358 default C havoc Fluffy_Pillow_Heavy_Spear2 158111.5/1100000: 14% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:45.461 default K life_tap Fluffy_Pillow 86693.6/1100000: 8% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(3)
1:46.564 default P rain_of_fire Fluffy_Pillow 433275.7/1100000: 39% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:47.650 default I conflagrate Fluffy_Pillow 449836.4/1100000: 41% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
1:48.736 default P rain_of_fire Fluffy_Pillow 466397.0/1100000: 42% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
1:49.820 default E immolate Fluffy_Pillow 482959.9/1100000: 44% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(5)
1:50.912 default S incinerate Fluffy_Pillow 433478.0/1100000: 39% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:52.271 default S incinerate Fluffy_Pillow 387323.0/1100000: 35% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:53.631 default G immolate Fluffy_Pillow 341182.7/1100000: 31% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:54.767 default I conflagrate Fluffy_Pillow 291771.4/1100000: 27% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:55.900 default C havoc Fluffy_Pillow_Heavy_Spear1 308316.3/1100000: 28% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:57.034 default J conflagrate Fluffy_Pillow 236875.8/1100000: 22% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:58.168 default F immolate Fluffy_Pillow_Heavy_Spear1 253435.3/1100000: 23% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:59.301 default F immolate Fluffy_Pillow_Heavy_Spear2 203980.2/1100000: 19% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:00.434 default R chaos_bolt Fluffy_Pillow 154525.9/1100000: 14% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:02.664 default J conflagrate Fluffy_Pillow 187570.8/1100000: 17% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:03.808 default R chaos_bolt Fluffy_Pillow 204125.6/1100000: 19% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:05.187 default J conflagrate Fluffy_Pillow 223965.9/1100000: 20% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:06.338 default K life_tap Fluffy_Pillow 240525.8/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:07.488 default O soul_harvest Fluffy_Pillow 587071.3/1100000: 53% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:07.488 default R chaos_bolt Fluffy_Pillow 587071.3/1100000: 53% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:08.866 default J conflagrate Fluffy_Pillow 606897.2/1100000: 55% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:10.009 default R chaos_bolt Fluffy_Pillow 623451.4/1100000: 57% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:11.370 default S incinerate Fluffy_Pillow 643325.7/1100000: 58% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:12.730 default Q dimensional_rift Fluffy_Pillow 597185.4/1100000: 54% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:13.864 default R chaos_bolt Fluffy_Pillow 613744.8/1100000: 56% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:15.224 default F immolate Fluffy_Pillow_Heavy_Spear2 633604.5/1100000: 58% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:16.358 default E immolate Fluffy_Pillow 584164.0/1100000: 53% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:17.492 default F immolate Fluffy_Pillow_Pack_Beast1 534723.5/1100000: 49% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:18.626 default F immolate Fluffy_Pillow_Pack_Beast2 485283.0/1100000: 44% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:19.760 default F immolate Fluffy_Pillow_Pack_Beast3 435842.5/1100000: 40% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
2:20.893 default F immolate Fluffy_Pillow_Pack_Beast4 386387.4/1100000: 35% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
2:22.031 default F immolate Fluffy_Pillow_Pack_Beast5 336894.8/1100000: 31% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
2:23.162 default Q dimensional_rift Fluffy_Pillow 287410.5/1100000: 26% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
2:24.294 default R chaos_bolt Fluffy_Pillow 303940.8/1100000: 28% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
2:26.558 default C havoc Fluffy_Pillow_Beast1 337002.4/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:27.671 default G immolate Fluffy_Pillow 265597.5/1100000: 24% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:28.773 default I conflagrate Fluffy_Pillow 216164.5/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:29.872 default J conflagrate Fluffy_Pillow 232692.7/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:30.959 default K life_tap Fluffy_Pillow 249268.6/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(4)
2:32.030 default R chaos_bolt Fluffy_Pillow 595830.3/1100000: 54% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(5)
2:34.168 default R chaos_bolt Fluffy_Pillow 628728.7/1100000: 57% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:35.525 default J conflagrate Fluffy_Pillow 648544.5/1100000: 59% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:36.657 default J conflagrate Fluffy_Pillow 665074.8/1100000: 60% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:37.791 default R chaos_bolt Fluffy_Pillow 681634.3/1100000: 62% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:39.152 default S incinerate Fluffy_Pillow 701508.6/1100000: 64% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:40.511 default R chaos_bolt Fluffy_Pillow 655377.4/1100000: 60% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:41.849 default S incinerate Fluffy_Pillow 675204.3/1100000: 61% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:43.191 default C havoc Fluffy_Pillow_Heavy_Spear2 629090.5/1100000: 57% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:44.310 default C havoc Fluffy_Pillow_Heavy_Spear2 557672.2/1100000: 51% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:45.427 default F immolate Fluffy_Pillow_Pack_Beast5 486224.3/1100000: 44% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:46.555 default J conflagrate Fluffy_Pillow 436773.7/1100000: 40% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:47.671 default S incinerate Fluffy_Pillow 453310.9/1100000: 41% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:49.011 default S incinerate Fluffy_Pillow 407205.8/1100000: 37% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:50.332 default E immolate Fluffy_Pillow 361065.2/1100000: 33% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:51.434 default K life_tap Fluffy_Pillow 311632.3/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:52.535 default S incinerate Fluffy_Pillow 658184.3/1100000: 60% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:53.857 default Q dimensional_rift Fluffy_Pillow 612058.7/1100000: 56% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:54.957 default S incinerate Fluffy_Pillow 628595.7/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:56.277 default C havoc Fluffy_Pillow_Heavy_Spear1 582440.1/1100000: 53% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:57.378 default R chaos_bolt Fluffy_Pillow 510992.1/1100000: 46% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:59.578 default S incinerate Fluffy_Pillow 543486.3/1100000: 49% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:00.958 default G immolate Fluffy_Pillow 497341.0/1100000: 45% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:02.112 default I conflagrate Fluffy_Pillow 447945.8/1100000: 41% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:03.245 default H berserking Fluffy_Pillow 464490.6/1100000: 42% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:03.245 default J conflagrate Fluffy_Pillow 464490.6/1100000: 42% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:04.230 default J conflagrate Fluffy_Pillow 481031.9/1100000: 44% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando
3:05.209 default N summon_infernal Fluffy_Pillow 497557.6/1100000: 45% mana | 4.0/5: 80% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:06.182 default Q dimensional_rift Fluffy_Pillow 514138.6/1100000: 47% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:07.154 default R chaos_bolt Fluffy_Pillow 530702.5/1100000: 48% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:09.097 default J conflagrate Fluffy_Pillow 563813.3/1100000: 51% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:10.069 default R chaos_bolt Fluffy_Pillow 580377.2/1100000: 53% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:11.236 default K life_tap Fluffy_Pillow 600264.2/1100000: 55% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:12.208 default S incinerate Fluffy_Pillow 946828.1/1100000: 86% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:13.373 default S incinerate Fluffy_Pillow 900397.3/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:14.695 default Q dimensional_rift Fluffy_Pillow 853889.8/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:15.846 default F immolate Fluffy_Pillow_Pack_Beast5 870449.7/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:16.997 default F immolate Fluffy_Pillow_Pack_Beast1 821037.6/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:18.131 default F immolate Fluffy_Pillow_Pack_Beast2 771597.1/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:19.265 default F immolate Fluffy_Pillow_Pack_Beast3 722179.2/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:20.383 default F immolate Fluffy_Pillow_Pack_Beast4 672746.1/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:21.499 default F immolate Fluffy_Pillow_Pack_Beast6 623283.4/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:22.617 default S incinerate Fluffy_Pillow 573850.2/1100000: 52% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:23.958 default E immolate Fluffy_Pillow 527721.6/1100000: 48% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:25.074 default C havoc Fluffy_Pillow_Heavy_Spear2 478258.8/1100000: 43% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:26.193 default R chaos_bolt Fluffy_Pillow 406840.5/1100000: 37% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:28.423 default G immolate Fluffy_Pillow 440034.6/1100000: 40% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:29.555 default I conflagrate Fluffy_Pillow 390608.1/1100000: 36% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:30.704 default J conflagrate Fluffy_Pillow 407139.2/1100000: 37% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:31.837 default J conflagrate Fluffy_Pillow 423684.1/1100000: 39% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:32.970 default K life_tap Fluffy_Pillow 440229.0/1100000: 40% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
3:34.104 default R chaos_bolt Fluffy_Pillow 786788.5/1100000: 72% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:36.368 default C havoc Fluffy_Pillow_Heavy_Spear1 819849.0/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:37.121 default C havoc Fluffy_Pillow_Heavy_Spear1 742844.9/1100000: 68% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:37.874 default C havoc Fluffy_Pillow_Heavy_Spear1 665840.7/1100000: 61% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:38.630 default C havoc Fluffy_Pillow_Heavy_Spear1 588880.4/1100000: 54% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:39.373 default C havoc Fluffy_Pillow_Heavy_Spear1 511890.4/1100000: 47% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:40.127 default C havoc Fluffy_Pillow_Heavy_Spear1 435063.4/1100000: 40% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:40.883 default C havoc Fluffy_Pillow_Heavy_Spear1 358266.1/1100000: 33% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:41.639 default C havoc Fluffy_Pillow_Heavy_Spear1 281468.7/1100000: 26% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:42.394 default C havoc Fluffy_Pillow_Heavy_Spear1 204656.5/1100000: 19% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:43.160 default C havoc Fluffy_Pillow_Heavy_Spear1 127810.9/1100000: 12% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
3:43.917 default J conflagrate Fluffy_Pillow 50702.1/1100000: 5% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
3:44.674 default R chaos_bolt Fluffy_Pillow 61593.4/1100000: 6% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
3:46.185 default F immolate Fluffy_Pillow_Pack_Beast6 83332.8/1100000: 8% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:46.942 default J conflagrate Fluffy_Pillow 28224.1/1100000: 3% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
3:48.297 default Q dimensional_rift Fluffy_Pillow 47719.0/1100000: 4% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:49.653 default R chaos_bolt Fluffy_Pillow 67228.3/1100000: 6% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:51.279 default E immolate Fluffy_Pillow 90623.4/1100000: 8% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando
3:52.614 default K life_tap Fluffy_Pillow 44118.0/1100000: 4% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando
3:53.951 default R chaos_bolt Fluffy_Pillow 393641.8/1100000: 36% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando
3:55.555 default C havoc Fluffy_Pillow_Heavy_Spear2 417066.1/1100000: 38% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:56.672 default F immolate Fluffy_Pillow_Heavy_Spear2 345618.2/1100000: 31% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:57.788 default S incinerate Fluffy_Pillow 296156.1/1100000: 27% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:59.110 default S incinerate Fluffy_Pillow 250031.6/1100000: 23% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
4:00.413 default S incinerate Fluffy_Pillow 203901.3/1100000: 19% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
4:01.715 default G immolate Fluffy_Pillow 157755.8/1100000: 14% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
4:02.800 default I conflagrate Fluffy_Pillow 108301.2/1100000: 10% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
4:03.925 default J conflagrate Fluffy_Pillow 124895.6/1100000: 11% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
4:05.075 default F immolate Fluffy_Pillow_Heavy_Spear1 141441.1/1100000: 13% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames
4:06.225 default R chaos_bolt Fluffy_Pillow 91986.6/1100000: 8% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames
4:08.522 default O soul_harvest Fluffy_Pillow 125036.2/1100000: 11% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:08.522 default R chaos_bolt Fluffy_Pillow 125036.2/1100000: 11% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:09.880 default J conflagrate Fluffy_Pillow 144866.7/1100000: 13% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:11.012 default J conflagrate Fluffy_Pillow 161397.0/1100000: 15% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:12.147 default K life_tap Fluffy_Pillow 177971.1/1100000: 16% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:13.281 default R chaos_bolt Fluffy_Pillow 524530.6/1100000: 48% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:14.640 default R chaos_bolt Fluffy_Pillow 544375.7/1100000: 49% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:15.998 default F immolate Fluffy_Pillow_Heavy_Spear1 564271.7/1100000: 51% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:17.117 default F immolate Fluffy_Pillow_Pack_Beast1 514853.4/1100000: 47% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:18.235 default F immolate Fluffy_Pillow_Pack_Beast2 465481.0/1100000: 42% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:19.334 default F immolate Fluffy_Pillow_Pack_Beast3 416003.0/1100000: 38% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3)
4:20.435 default F immolate Fluffy_Pillow_Pack_Beast4 366557.1/1100000: 33% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4)
4:21.581 default F immolate Fluffy_Pillow_Pack_Beast5 317113.2/1100000: 29% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:22.731 default F immolate Fluffy_Pillow_Pack_Beast6 267658.7/1100000: 24% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:23.880 default R chaos_bolt Fluffy_Pillow 218189.9/1100000: 20% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:26.178 default C havoc Fluffy_Pillow_Heavy_Spear2 251265.1/1100000: 23% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:27.310 default E immolate Fluffy_Pillow 179795.3/1100000: 16% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:28.443 default G immolate Fluffy_Pillow 130340.2/1100000: 12% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:29.577 default I conflagrate Fluffy_Pillow 80899.7/1100000: 7% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:30.713 default I conflagrate Fluffy_Pillow 97488.4/1100000: 9% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:31.847 default I conflagrate Fluffy_Pillow 114047.9/1100000: 10% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:32.980 default K life_tap Fluffy_Pillow 130592.8/1100000: 12% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:34.113 default Q dimensional_rift Fluffy_Pillow 477137.6/1100000: 43% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:35.229 default C havoc Fluffy_Pillow_Heavy_Spear1 493674.9/1100000: 45% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:36.346 default C havoc Fluffy_Pillow_Heavy_Spear1 422227.0/1100000: 38% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:37.463 default C havoc Fluffy_Pillow_Heavy_Spear1 350779.0/1100000: 32% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:38.594 default C havoc Fluffy_Pillow_Heavy_Spear1 279333.4/1100000: 25% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:39.729 default C havoc Fluffy_Pillow_Heavy_Spear1 207907.5/1100000: 19% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:40.862 default C havoc Fluffy_Pillow_Heavy_Spear1 136452.4/1100000: 12% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:41.995 default I conflagrate Fluffy_Pillow 65011.9/1100000: 6% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:43.112 default F immolate Fluffy_Pillow_Heavy_Spear1 81564.0/1100000: 7% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:44.228 default I conflagrate Fluffy_Pillow 32101.2/1100000: 3% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:45.347 default P rain_of_fire Fluffy_Pillow 48682.9/1100000: 4% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:46.465 default R chaos_bolt Fluffy_Pillow 65249.8/1100000: 6% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
4:47.933 default F immolate Fluffy_Pillow_Heavy_Spear2 87003.1/1100000: 8% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:48.687 default T life_tap Fluffy_Pillow 32176.1/1100000: 3% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:49.442 default S incinerate Fluffy_Pillow 373364.0/1100000: 34% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:50.325 default I conflagrate Fluffy_Pillow 320448.5/1100000: 29% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:51.234 default R chaos_bolt Fluffy_Pillow 333642.6/1100000: 30% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
4:52.143 default E immolate Fluffy_Pillow 346721.8/1100000: 32% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:52.899 default S incinerate Fluffy_Pillow 291761.5/1100000: 27% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:53.795 default Q dimensional_rift Fluffy_Pillow 238845.5/1100000: 22% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:54.548 default S incinerate Fluffy_Pillow 249841.4/1100000: 23% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:55.443 default C havoc Fluffy_Pillow_Heavy_Spear2 196910.8/1100000: 18% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:56.193 default F immolate Fluffy_Pillow_Heavy_Spear2 119917.0/1100000: 11% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
4:56.947 default T life_tap Fluffy_Pillow 65090.0/1100000: 6% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
4:57.701 default F immolate Fluffy_Pillow_Heavy_Spear1 406263.0/1100000: 37% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(2)
4:59.016 default I conflagrate Fluffy_Pillow 359749.1/1100000: 33% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(2)
5:00.328 default S incinerate Fluffy_Pillow 379250.4/1100000: 34% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51868 51868 33640
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3112080 3112080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 13.94% 13.94% 3577
Haste 30.79% 29.79% 11173
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14387 14277 0
Mastery 67.65% 67.65% 5819
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 905.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="RB/ELT/SH/Sac/WH"
level=110
race=troll
role=spell
position=back
talents=2303031
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=904.60
# gear_stamina=33640
# gear_intellect=38456
# gear_crit_rating=3577
# gear_haste_rating=11173
# gear_mastery_rating=5819
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

RB/ELT/SH/Serv/CDF : 806554 dps, 480235 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
806553.6 806553.6 775.0 / 0.096% 154435.2 / 19.1% 22.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
27590.2 27590.2 Mana 0.00% 50.5 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Channel Demonfire (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
RB/ELT/SH/Serv/CDF 806554
Channel Demonfire 0 (128025) 0.0% (15.9%) 21.7 13.84sec 1772785 785595

Stats details: channel_demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.67 0.00 322.17 0.00 2.2566 0.1347 0.00 0.00 0.00 785594.77 785594.77
 
 

Action details: channel_demonfire

Static Values
  • id:196447
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:52800.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.immolate.remains>cast_time
Spelldata
  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Channel Demonfire (_tick) 128025 15.9% 0.0 0.00sec 0 0 Direct 879.5 38328 76675 43682 14.0%  

Stats details: channel_demonfire_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 879.45 0.00 0.00 0.0000 0.0000 38416370.03 38416370.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 756.66 86.04% 38327.85 18255 80790 38532.25 34542 48366 29001036 29001036 0.00
crit 122.80 13.96% 76675.26 36508 161580 77096.62 64869 98418 9415334 9415334 0.00
 
 

Action details: channel_demonfire_tick

Static Values
  • id:196448
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.640000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Chaos Bolt 114661 14.2% 34.5 8.29sec 997111 628503 Direct 44.2 0 779620 779620 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.52 44.16 0.00 0.00 1.5865 0.0000 34425001.58 34425001.58 0.00 628503.12 628503.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 44.16 100.00% 779620.40 511955 1132772 779959.13 703031 854124 34425002 34425002 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 66391 8.2% 48.5 6.19sec 410760 404654 Direct 60.6 193900 435350 328487 55.7%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.50 60.65 0.00 0.00 1.0151 0.0000 19922338.82 19922338.82 0.00 404654.17 404654.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.84 44.26% 193900.24 129239 285982 193940.68 166756 220728 5204597 5204597 0.00
crit 33.81 55.74% 435350.34 258614 651725 435364.94 387927 492445 14717742 14717742 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 13934 1.7% 34.0 4.82sec 120916 0 Direct 33.6 107387 214656 122405 14.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.01 33.59 0.00 0.00 0.0000 0.0000 4111828.36 4111828.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.89 86.00% 107386.77 87244 115162 107381.24 101323 112283 3102198 3102198 0.00
crit 4.70 14.00% 214655.85 174488 230324 212893.78 0 230324 1009631 1009631 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 239705 29.8% 89.7 3.32sec 802500 768126 Direct 97.9 134595 269188 196342 45.9%  
Periodic 344.3 104991 210011 153248 46.0% 227.8%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.70 97.88 344.34 344.34 1.0448 1.9899 71987201.52 71987201.52 0.00 92419.96 768125.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.98 54.12% 134594.67 89660 198414 134617.67 121666 149974 7130280 7130280 0.00
crit 44.90 45.88% 269188.00 179320 396828 269233.93 243325 295772 12087732 12087732 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 186.1 54.05% 104991.21 56 409918 105171.28 93299 121074 19540544 19540544 0.00
crit 158.2 45.95% 210010.65 152 819915 210370.91 182586 242864 33228646 33228646 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 4030 0.5% 4.3 37.79sec 280919 249659 Direct 4.8 220540 440876 250822 13.7%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.83 0.00 0.00 1.1254 0.0000 1210346.40 1210346.40 0.00 249658.91 249658.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.16 86.26% 220540.11 144945 320727 203114.11 0 320207 917971 917971 0.00
crit 0.66 13.74% 440876.21 294726 641443 201834.06 0 641443 292375 292375 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9489 1.2% 20.2 14.92sec 141301 0 Direct 20.2 123885 247705 141303 14.1%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.16 20.16 0.00 0.00 0.0000 0.0000 2848188.06 2848188.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.32 85.93% 123885.20 109698 144802 123876.07 116402 134459 2145883 2145883 0.00
crit 2.84 14.07% 247705.09 219396 289603 232694.80 0 289603 702305 702305 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Rain of Fire 43340 5.4% 6.8 31.61sec 1916821 1888795 Periodic 242.0 47134 94325 53713 13.9% 0.0%

Stats details: rain_of_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 0.00 0.00 242.00 1.0150 0.0000 12998686.60 12998686.60 0.00 1888794.91 1888794.91
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 208.3 86.06% 47133.84 31659 70060 47035.35 0 58285 9816241 9816241 0.00
crit 33.7 13.94% 94325.21 63321 140119 94106.25 0 123889 3182446 3182446 0.00
 
 

Action details: rain_of_fire

Static Values
  • id:5740
  • school:fire
  • resource:soul_shard
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
Spelldata
  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.
 
pet - imp 41644 / 41644
Firebolt 41644 5.2% 109.6 2.74sec 114118 92304 Direct 109.6 100126 200207 114117 14.0%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.59 109.59 0.00 0.00 1.2363 0.0000 12505732.86 12505732.86 0.00 92304.13 92304.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 94.27 86.02% 100125.54 64723 116502 100132.33 97959 101998 9438368 9438368 0.00
crit 15.32 13.98% 200207.28 129446 233004 200209.98 161808 218882 3067365 3067365 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 119049 / 37890
Firebolt 119049 4.7% 49.2 5.49sec 230869 197862 Direct 49.2 202546 405337 230870 14.0%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.17 49.17 0.00 0.00 1.1668 0.0000 11350737.86 11350737.86 0.00 197861.80 197861.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.30 86.03% 202546.18 129446 233004 202683.63 196471 210566 8567434 8567434 0.00
crit 6.87 13.97% 405336.58 258893 466007 405416.84 0 466007 2783304 2783304 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 154523 / 25877
Immolation 134676 2.8% 2.0 183.11sec 3322598 0 Periodic 155.5 37576 75170 42834 14.0% 16.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 38.84 155.48 0.0000 1.2398 6659816.64 6659816.64 0.00 138322.57 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.7 86.02% 37576.14 34281 41137 37604.37 36695 40410 5025322 5025322 0.00
crit 21.7 13.98% 75170.49 68561 82274 75220.54 68561 82274 1634494 1634494 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 19847 0.4% 38.8 5.43sec 25291 20399 Direct 38.8 22190 44382 25291 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.84 38.84 0.00 0.00 1.2398 0.0000 982172.45 1443886.54 31.98 20399.45 20399.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.41 86.03% 22190.38 20500 24600 22201.12 21631 23953 741377 1089895 31.98
crit 5.43 13.97% 44381.85 41000 49200 44286.14 0 49200 240795 353992 31.89
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 81831 / 8211
Doom Bolt 81831 0.8% 9.8 2.22sec 205720 93424 Direct 9.8 181044 362263 205720 13.6%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.77 9.77 0.00 0.00 2.2020 0.0000 2009648.53 2009648.53 0.00 93424.23 93424.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.44 86.38% 181043.74 181003 217204 162561.42 0 217204 1527770 1527770 0.00
crit 1.33 13.62% 362263.28 362007 434408 256478.21 0 434408 481879 481879 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 193353 / 16386
Immolation 169620 1.8% 1.0 0.00sec 4240663 0 Periodic 93.6 39756 79511 45303 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.22 93.61 0.0000 1.0919 4240662.68 4240662.68 0.00 174800.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.5 86.05% 39755.72 34281 41137 39774.53 38726 40497 3202147 3202147 0.00
crit 13.1 13.95% 79511.19 68561 82274 79552.11 71989 82274 1038516 1038516 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23734 0.2% 22.2 1.10sec 26706 24459 Direct 22.2 23453 46897 26706 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.22 22.22 0.00 0.00 1.0919 0.0000 593365.32 872303.23 31.98 24458.59 24458.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.14 86.13% 23453.21 20500 24600 23454.30 22687 24144 448797 659774 31.98
crit 3.08 13.87% 46897.09 41000 49200 45064.55 0 49200 144569 212529 30.72
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 193286 / 16381
Immolation 169543 1.8% 1.0 0.00sec 4238743 0 Periodic 93.6 39756 79508 45282 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.22 93.61 0.0000 1.0919 4238743.46 4238743.46 0.00 174721.49 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.6 86.10% 39756.01 34281 41137 39774.92 38737 40565 3204066 3204066 0.00
crit 13.0 13.90% 79507.56 68561 82274 79551.01 72675 82274 1034678 1034678 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23743 0.2% 22.2 1.10sec 26716 24468 Direct 22.2 23453 46904 26716 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.22 22.22 0.00 0.00 1.0919 0.0000 593589.21 872632.36 31.98 24467.82 24467.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.13 86.08% 23452.64 20500 24600 23453.51 22806 24359 448573 659445 31.98
crit 3.09 13.92% 46904.23 41000 49200 45266.02 0 49200 145016 213188 30.87
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 193281 / 16380
Immolation 169540 1.8% 1.0 0.00sec 4238657 0 Periodic 93.6 39755 79519 45281 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.22 93.61 0.0000 1.0919 4238657.06 4238657.06 0.00 174717.93 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.6 86.10% 39755.05 34281 41137 39773.97 38851 40625 3204152 3204152 0.00
crit 13.0 13.90% 79519.44 68561 82274 79559.79 71304 82274 1034505 1034505 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 23742 0.2% 22.2 1.10sec 26715 24467 Direct 22.2 23451 46921 26716 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.22 22.22 0.00 0.00 1.0919 0.0000 593572.39 872607.64 31.98 24467.12 24467.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.13 86.09% 23451.24 20500 24600 23452.07 22843 24144 448590 659469 31.98
crit 3.09 13.91% 46921.47 41000 49200 45332.50 0 49200 144983 213138 30.90
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 113145 / 14134
Shadow Bolt 113145 1.7% 3.1 83.03sec 1341370 0 Periodic 34.3 108208 216572 123248 13.9% 14.2%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.15 0.00 34.27 34.27 0.0000 1.2477 4223168.00 4223168.00 0.00 98785.24 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.5 86.12% 108207.71 95 126576 107860.69 0 126576 3193167 3193167 0.00
crit 4.8 13.88% 216572.11 225 253152 207998.29 0 253152 1030001 1030001 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 132316 / 6577
Chaos Bolt 132316 0.8% 3.1 77.39sec 631394 306868 Direct 3.1 0 631397 631397 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.12 3.12 0.00 0.00 2.0578 0.0000 1969783.83 1969783.83 0.00 306867.71 306867.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.12 100.00% 631397.16 600929 721115 631067.69 0 721115 1969784 1969784 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 225872 / 12419
Chaos Barrage 225872 1.5% 3.2 81.97sec 1166620 0 Periodic 107.3 30303 60559 34530 14.0% 5.7%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.18 0.00 107.34 107.34 0.0000 0.1607 3706325.45 3706325.45 0.00 214921.74 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.3 86.03% 30303.34 152 34809 30203.06 0 34809 2798250 2798250 0.00
crit 15.0 13.97% 60559.14 304 69619 60244.62 0 69619 908075 908075 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
RB/ELT/SH/Serv/CDF
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Serv/CDF
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.78sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 9.2 37.52sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.22 0.00 0.00 0.00 0.9957 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Serv/CDF
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:RB/ELT/SH/Serv/CDF
  • harmful:false
  • if_expr:
 
Havoc 10.8 28.22sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 0.00 0.00 0.00 1.0350 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 14.2 21.84sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.20 0.00 0.00 0.00 0.9801 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.73sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.65 0.00 0.00 0.00 0.9592 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.51sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 0.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.02 0.00 0.00 0.00 0.9870 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 2.0 183.11sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8571 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.0 0.0 15.4sec 15.4sec 78.34% 78.34% 1.7(1.7) 19.2

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.56%
  • accelerando_2:24.15%
  • accelerando_3:14.54%
  • accelerando_4:6.72%
  • accelerando_5:3.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.8sec 180.8sec 6.85% 7.07% 0.0(0.0) 2.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 12.79% 0.0(0.0) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.2 0.0 12.3sec 12.3sec 49.39% 48.39% 0.0(0.0) 0.2

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.39%

Trigger Attempt Success

  • trigger_pct:49.92%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.1sec 69.1sec 8.78% 8.78% 0.0(0.0) 3.3

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.78%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 20.5 15.0 14.9sec 8.3sec 36.79% 50.39% 15.0(15.0) 20.1

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:36.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 10.0 4.2 31.5sec 21.8sec 90.55% 90.81% 52.0(52.0) 9.1

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:90.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 98.04% 51.30% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:98.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.5sec 68.6sec 13.67% 13.67% 0.0(0.0) 3.3

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.67%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 128.0sec 0.0sec 19.66% 19.66% 0.0(0.0) 2.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 1.5 0.0 85.9sec 85.9sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.32%
Soul Harvest 2.9 0.0 121.5sec 121.5sec 17.57% 17.57% 0.0(0.0) 2.7

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.1 78.6sec
chaos_tear 3.1 78.3sec
chaos_portal 3.1 78.1sec
dimension_ripper 0.2 93.5sec

Resources

Resource Usage Type Count Total Average RPE APR
RB/ELT/SH/Serv/CDF
channel_demonfire Mana 21.7 1144154.8 52800.0 52798.9 33.6
chaos_bolt Soul Shard 35.5 71.0 2.0 2.1 484532.4
havoc Mana 10.8 949525.5 88000.0 88000.7 0.0
immolate Mana 89.7 5920628.2 66000.0 66002.1 12.2
incinerate Mana 4.3 284328.5 66000.0 65992.0 4.3
rain_of_fire Soul Shard 6.8 20.3 3.0 3.0 638913.2
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 0.0 0.0 1.0 1.0 0.0
summon_infernal Soul Shard 2.0 2.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.6 4383.4 40.0 40.0 2852.9
pet - service_imp
firebolt Energy 49.2 1966.6 40.0 40.0 5771.6
pet - doomguard
doom_bolt Energy 0.2 7.2 35.0 0.7 277333.4
Resource Gains Type Count Total Average Overflow
life_tap Mana 14.20 3727533.32 (46.73%) 262453.57 959337.62 20.47%
immolate Soul Shard 75.41 49.66 (50.79%) 0.66 25.75 34.15%
conflagrate Soul Shard 48.50 42.77 (43.75%) 0.88 5.73 11.81%
mp5_regen Mana 830.39 4249863.03 (53.27%) 5117.91 415317.91 8.90%
soulsnatcher Soul Shard 5.34 5.34 (5.46%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1869.03 4217.11 (100.00%) 2.26 22.75 0.54%
pet - service_imp
energy_regen Energy 427.93 1351.34 (100.00%) 3.16 63.64 4.50%
pet - doomguard
energy_regen Energy 0.21 6.58 (100.00%) 31.76 0.80 10.90%
Resource RPS-Gain RPS-Loss
Health 0.00 14695.38
Mana 26522.50 27590.22
Soul Shard 0.33 0.32
Combat End Resource Mean Min Max
Mana 779755.91 72542.41 1100000.00
Soul Shard 3.66 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 8.3%

Statistics & Data Analysis

Fight Length
Sample Data RB/ELT/SH/Serv/CDF Fight Length
Count 9999
Mean 300.78
Minimum 214.57
Maximum 375.75
Spread ( max - min ) 161.18
Range [ ( max - min ) / 2 * 100% ] 26.79%
DPS
Sample Data RB/ELT/SH/Serv/CDF Damage Per Second
Count 9999
Mean 806553.56
Minimum 677124.28
Maximum 965733.74
Spread ( max - min ) 288609.46
Range [ ( max - min ) / 2 * 100% ] 17.89%
Standard Deviation 39538.9872
5th Percentile 744259.74
95th Percentile 874311.25
( 95th Percentile - 5th Percentile ) 130051.51
Mean Distribution
Standard Deviation 395.4096
95.00% Confidence Intervall ( 805778.57 - 807328.55 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9232
0.1 Scale Factor Error with Delta=300 13345497
0.05 Scale Factor Error with Delta=300 53381988
0.01 Scale Factor Error with Delta=300 1334549695
Priority Target DPS
Sample Data RB/ELT/SH/Serv/CDF Priority Target Damage Per Second
Count 9999
Mean 480235.05
Minimum 418756.46
Maximum 557957.12
Spread ( max - min ) 139200.66
Range [ ( max - min ) / 2 * 100% ] 14.49%
Standard Deviation 18848.0140
5th Percentile 450799.97
95th Percentile 512445.78
( 95th Percentile - 5th Percentile ) 61645.81
Mean Distribution
Standard Deviation 188.4896
95.00% Confidence Intervall ( 479865.61 - 480604.48 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5918
0.1 Scale Factor Error with Delta=300 3032599
0.05 Scale Factor Error with Delta=300 12130393
0.01 Scale Factor Error with Delta=300 303259810
DPS(e)
Sample Data RB/ELT/SH/Serv/CDF Damage Per Second (Effective)
Count 9999
Mean 806553.56
Minimum 677124.28
Maximum 965733.74
Spread ( max - min ) 288609.46
Range [ ( max - min ) / 2 * 100% ] 17.89%
Damage
Sample Data RB/ELT/SH/Serv/CDF Damage
Count 9999
Mean 185919961.36
Minimum 128998731.89
Maximum 263453427.31
Spread ( max - min ) 134454695.42
Range [ ( max - min ) / 2 * 100% ] 36.16%
DTPS
Sample Data RB/ELT/SH/Serv/CDF Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data RB/ELT/SH/Serv/CDF Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data RB/ELT/SH/Serv/CDF Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data RB/ELT/SH/Serv/CDF Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data RB/ELT/SH/Serv/CDF Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data RB/ELT/SH/Serv/CDF Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RB/ELT/SH/Serv/CDFTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data RB/ELT/SH/Serv/CDF Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 10.80 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 11.22 immolate,if=remains<=tick_time
F 70.56 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 10.06 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 18.51 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 29.99 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 12.63 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
0.00 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
M 3.65 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 0.02 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
P 1.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
Q 2.88 soul_harvest
R 21.67 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
S 6.78 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
T 8.22 dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
U 35.17 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
V 4.39 incinerate
W 0.57 life_tap

Sample Sequence

01269ABDEGHJKMKNQRTTUCUKFRUKFFFFLSREGJUUKKKRCFFUUKLRFFFESSTUCGJKKLRFUUKUKURFFEFFFFCLRTGJUMKFFRUCJLUUREJKFFUKKRCLQIUUEVTRUGJKFFFFFFCLRUKUKFFREUSGJKFFFFFCLRJTUHUMVJPERGJKFFFFFLSKFFFCKRUKUVVEFFRLUUVCGJTUUKFFKFFRLUUCJUEQRGJKFFFFFLRCJUJJTUJEFFGMJLRFFFFFFJJCFFRJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask RB/ELT/SH/Serv/CDF 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food RB/ELT/SH/Serv/CDF 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation RB/ELT/SH/Serv/CDF 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 9 life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 default D dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.103 default E immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.977 default G immolate Fluffy_Pillow 1034096.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:02.838 default H berserking Fluffy_Pillow 984682.5/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:02.838 default J conflagrate Fluffy_Pillow 984682.5/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.592 default K conflagrate Fluffy_Pillow 1001386.1/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:04.346 default M service_imp Fluffy_Pillow 1018089.8/1100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:05.101 default K conflagrate Fluffy_Pillow 1034815.6/1100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:05.844 default N summon_infernal Fluffy_Pillow 1051514.7/1100000: 96% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(3), potion_of_deadly_grace
0:06.599 default Q soul_harvest Fluffy_Pillow 1068483.5/1100000: 97% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:06.599 default R channel_demonfire Fluffy_Pillow 1068483.5/1100000: 97% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:08.234 default T dimensional_rift Fluffy_Pillow 1052430.6/1100000: 96% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:08.992 default T dimensional_rift Fluffy_Pillow 1069466.9/1100000: 97% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:09.745 default U chaos_bolt Fluffy_Pillow 1086390.7/1100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:11.218 default C havoc Fluffy_Pillow_Beast1 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:11.973 default U chaos_bolt Fluffy_Pillow 1029212.2/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:12.845 default K conflagrate Fluffy_Pillow 1047983.3/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:13.730 default F immolate Fluffy_Pillow_Beast1 1064536.1/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:14.617 default R channel_demonfire Fluffy_Pillow 1015126.2/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:16.636 default U chaos_bolt Fluffy_Pillow 1000088.8/1100000: 91% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:17.698 default K conflagrate Fluffy_Pillow 1019952.1/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:18.585 default F immolate Fluffy_Pillow_Pack_Beast1 1036542.2/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:19.472 default F immolate Fluffy_Pillow_Pack_Beast2 987132.3/1100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:20.358 default F immolate Fluffy_Pillow_Pack_Beast3 937703.8/1100000: 85% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:21.244 default F immolate Fluffy_Pillow_Pack_Beast4 888307.4/1100000: 81% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:22.117 default L life_tap Fluffy_Pillow 839005.9/1100000: 76% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:22.977 default S rain_of_fire Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:23.830 default R channel_demonfire Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
0:25.701 default E immolate Fluffy_Pillow 1083766.3/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
0:26.551 default G immolate Fluffy_Pillow 1034117.3/1100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
0:27.399 default J conflagrate Fluffy_Pillow 984690.3/1100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
0:28.247 default U chaos_bolt Fluffy_Pillow 1001267.3/1100000: 91% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
0:29.917 default U chaos_bolt Fluffy_Pillow 1034373.4/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:30.919 default K conflagrate Fluffy_Pillow 1054237.0/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:31.756 default K conflagrate Fluffy_Pillow 1070829.7/1100000: 97% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:32.593 default K conflagrate Fluffy_Pillow 1087422.4/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
0:33.448 default R channel_demonfire Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:35.523 default C havoc Fluffy_Pillow_Heavy_Spear1 1086459.8/1100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
0:36.397 default F immolate Fluffy_Pillow_Heavy_Spear1 1015051.5/1100000: 92% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
0:37.270 default F immolate Fluffy_Pillow_Heavy_Spear2 965624.1/1100000: 88% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
0:38.143 default U chaos_bolt Fluffy_Pillow 916196.7/1100000: 83% mana | 5.0/5: 100% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
0:39.886 default U chaos_bolt Fluffy_Pillow 949285.0/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:40.931 default K conflagrate Fluffy_Pillow 969122.8/1100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:42.046 default L life_tap Fluffy_Pillow 985404.8/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:43.179 default R channel_demonfire Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:45.654 default F immolate Fluffy_Pillow_Pack_Beast1 1084375.9/1100000: 99% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
0:46.790 default F immolate Fluffy_Pillow_Pack_Beast2 1034561.1/1100000: 94% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
0:47.940 default F immolate Fluffy_Pillow_Pack_Beast3 985107.5/1100000: 90% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
0:49.074 default E immolate Fluffy_Pillow 935667.0/1100000: 85% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
0:50.207 default S rain_of_fire Fluffy_Pillow 886211.9/1100000: 81% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
0:51.340 default S rain_of_fire Fluffy_Pillow 902756.7/1100000: 82% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando
0:52.473 default T dimensional_rift Fluffy_Pillow 919301.6/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
0:53.607 default U chaos_bolt Fluffy_Pillow 935861.1/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
0:55.869 default C havoc Fluffy_Pillow_Heavy_Spear2 968893.1/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:56.986 default G immolate Fluffy_Pillow 897445.2/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:58.103 default J conflagrate Fluffy_Pillow 847997.2/1100000: 77% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:59.221 default K conflagrate Fluffy_Pillow 864564.1/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:00.336 default K conflagrate Fluffy_Pillow 881097.9/1100000: 80% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
1:01.487 default L life_tap Fluffy_Pillow 897657.8/1100000: 82% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
1:02.638 default R channel_demonfire Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
1:05.125 default F immolate Fluffy_Pillow_Heavy_Spear1 1083091.5/1100000: 98% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:06.259 default U chaos_bolt Fluffy_Pillow 1033651.0/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:08.522 default U chaos_bolt Fluffy_Pillow 1066698.9/1100000: 97% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:09.862 default K conflagrate Fluffy_Pillow 1086555.4/1100000: 99% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:10.981 default U chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:12.322 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:13.440 default U chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:14.781 default R channel_demonfire Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:17.229 default F immolate Fluffy_Pillow_Heavy_Spear1 1083210.2/1100000: 98% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:18.380 default F immolate Fluffy_Pillow_Pack_Beast1 1033771.2/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:19.515 default E immolate Fluffy_Pillow 984346.6/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:20.632 default F immolate Fluffy_Pillow_Pack_Beast2 935027.2/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:21.734 default F immolate Fluffy_Pillow_Pack_Beast3 885594.3/1100000: 81% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:22.835 default F immolate Fluffy_Pillow_Pack_Beast4 836146.3/1100000: 76% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(3)
1:23.937 default F immolate Fluffy_Pillow_Pack_Beast5 786713.3/1100000: 72% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(3)
1:25.037 default C havoc Fluffy_Pillow_Beast1 803250.3/1100000: 73% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(3)
1:26.140 default L life_tap Fluffy_Pillow 731832.4/1100000: 67% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando(3)
1:27.241 default R channel_demonfire Fluffy_Pillow 1078384.4/1100000: 98% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:29.793 default T dimensional_rift Fluffy_Pillow 1064500.5/1100000: 97% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
1:31.130 default G immolate Fluffy_Pillow 1084238.0/1100000: 99% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
1:32.284 default J conflagrate Fluffy_Pillow 1034116.8/1100000: 94% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:33.417 default U chaos_bolt Fluffy_Pillow 1050661.7/1100000: 96% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:35.682 default M service_imp Fluffy_Pillow 1083738.2/1100000: 99% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:36.800 default K conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:37.918 default F immolate Fluffy_Pillow_Heavy_Spear2 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:39.036 default F immolate Fluffy_Pillow_Heavy_Spear1 1034074.1/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:40.153 default R channel_demonfire Fluffy_Pillow 984626.2/1100000: 90% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:42.559 default U chaos_bolt Fluffy_Pillow 967479.0/1100000: 88% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:44.790 default C havoc Fluffy_Pillow_Heavy_Spear2 1000489.0/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:46.170 default J conflagrate Fluffy_Pillow 932640.8/1100000: 85% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:47.304 default L life_tap Fluffy_Pillow 949200.3/1100000: 86% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando
1:48.436 default U chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:49.795 default U chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:51.135 default R channel_demonfire Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:53.837 default E immolate Fluffy_Pillow 1084176.2/1100000: 99% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:54.940 default J conflagrate Fluffy_Pillow 1034090.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:56.041 default K conflagrate Fluffy_Pillow 1050642.2/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:57.158 default F immolate Fluffy_Pillow_Heavy_Spear1 1067193.7/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:58.308 default F immolate Fluffy_Pillow_Heavy_Spear2 1017833.4/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:59.443 default U chaos_bolt Fluffy_Pillow 968407.4/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:01.706 default K conflagrate Fluffy_Pillow 1001785.9/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:02.824 default K conflagrate Fluffy_Pillow 1018352.7/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:03.941 default R channel_demonfire Fluffy_Pillow 1034904.8/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:06.490 default C havoc Fluffy_Pillow_Heavy_Spear1 1019876.7/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:07.593 default L life_tap Fluffy_Pillow 948458.8/1100000: 86% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:08.696 default Q soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:08.696 default I potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:08.696 default U chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:10.895 default U chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:12.276 default E immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:13.425 default V incinerate Fluffy_Pillow 1034043.8/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:14.783 default T dimensional_rift Fluffy_Pillow 987874.3/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:16.135 default R channel_demonfire Fluffy_Pillow 1007617.2/1100000: 92% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:18.555 default U chaos_bolt Fluffy_Pillow 990677.5/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:20.023 default G immolate Fluffy_Pillow 1012430.8/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:20.770 default J conflagrate Fluffy_Pillow 957600.9/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:21.524 default K conflagrate Fluffy_Pillow 968936.2/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:22.280 default F immolate Fluffy_Pillow_Heavy_Spear2 980301.6/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:23.034 default F immolate Fluffy_Pillow_Pack_Beast1 925637.0/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:23.789 default F immolate Fluffy_Pillow_Pack_Beast2 870987.4/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:24.543 default F immolate Fluffy_Pillow_Pack_Beast3 816322.7/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:25.296 default F immolate Fluffy_Pillow_Beast1 827643.1/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:26.078 default F immolate Fluffy_Pillow_Heavy_Spear1 772975.4/1100000: 70% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, potion_of_deadly_grace
2:26.836 default C havoc Fluffy_Pillow_Beast1 717881.1/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, potion_of_deadly_grace
2:27.594 default L life_tap Fluffy_Pillow 640786.7/1100000: 58% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, nefarious_pact, potion_of_deadly_grace
2:28.352 default R channel_demonfire Fluffy_Pillow 981692.4/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, potion_of_deadly_grace
2:30.093 default U chaos_bolt Fluffy_Pillow 953940.9/1100000: 87% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, devils_due, potion_of_deadly_grace
2:32.800 default K conflagrate Fluffy_Pillow 993358.7/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
2:34.133 default U chaos_bolt Fluffy_Pillow 1012824.1/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
2:35.735 default K conflagrate Fluffy_Pillow 1036218.8/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:37.051 default F immolate Fluffy_Pillow_Heavy_Spear1 1055719.7/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:38.368 default F immolate Fluffy_Pillow_Heavy_Spear2 1009235.4/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:39.485 default R channel_demonfire Fluffy_Pillow 959787.5/1100000: 87% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:42.122 default E immolate Fluffy_Pillow 946063.4/1100000: 86% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:43.251 default U chaos_bolt Fluffy_Pillow 896611.8/1100000: 82% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:45.514 default S rain_of_fire Fluffy_Pillow 929746.1/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:46.615 default G immolate Fluffy_Pillow 946298.2/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:47.717 default J conflagrate Fluffy_Pillow 896865.2/1100000: 82% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:48.819 default K conflagrate Fluffy_Pillow 913432.3/1100000: 83% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:49.920 default F immolate Fluffy_Pillow_Pack_Beast1 929984.3/1100000: 85% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
2:51.023 default F immolate Fluffy_Pillow_Pack_Beast5 880566.4/1100000: 80% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
2:52.124 default F immolate Fluffy_Pillow_Pack_Beast6 831118.4/1100000: 76% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
2:53.226 default F immolate Fluffy_Pillow_Pack_Beast2 781734.6/1100000: 71% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(4)
2:54.312 default F immolate Fluffy_Pillow_Pack_Beast3 732296.1/1100000: 67% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(5)
2:55.425 default C havoc Fluffy_Pillow_Heavy_Spear1 748851.1/1100000: 68% mana | 3.0/5: 60% soul_shard lord_of_flames
2:56.577 default L life_tap Fluffy_Pillow 677425.4/1100000: 62% mana | 3.0/5: 60% soul_shard lord_of_flames
2:57.728 default R channel_demonfire Fluffy_Pillow 1023985.3/1100000: 93% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames
3:00.253 default J conflagrate Fluffy_Pillow 1007513.6/1100000: 92% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames
3:01.405 default T dimensional_rift Fluffy_Pillow 1024087.9/1100000: 93% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:02.547 default U chaos_bolt Fluffy_Pillow 1040620.6/1100000: 95% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:04.811 default H berserking Fluffy_Pillow 1073777.3/1100000: 98% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:04.811 default U chaos_bolt Fluffy_Pillow 1073777.3/1100000: 98% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:05.979 default M service_imp Fluffy_Pillow 1093681.2/1100000: 99% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:06.953 default V incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:08.118 default J conflagrate Fluffy_Pillow 1034068.2/1100000: 94% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:09.090 default P summon_infernal Fluffy_Pillow 1050632.1/1100000: 96% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:10.049 default E immolate Fluffy_Pillow 1067211.9/1100000: 97% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:11.007 default R channel_demonfire Fluffy_Pillow 1017774.5/1100000: 93% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:13.194 default G immolate Fluffy_Pillow 1002886.2/1100000: 91% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:14.143 default J conflagrate Fluffy_Pillow 953458.1/1100000: 87% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:15.196 default K conflagrate Fluffy_Pillow 970049.6/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
3:16.347 default F immolate Fluffy_Pillow_Pack_Beast3 986609.5/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:17.497 default F immolate Fluffy_Pillow_Pack_Beast1 937155.1/1100000: 85% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
3:18.254 default F immolate Fluffy_Pillow_Pack_Beast2 882046.3/1100000: 80% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
3:19.012 default F immolate Fluffy_Pillow_Pack_Beast4 826952.0/1100000: 75% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
3:19.771 default F immolate Fluffy_Pillow_Pack_Beast5 771872.1/1100000: 70% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
3:20.528 default L life_tap Fluffy_Pillow 716763.3/1100000: 65% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
3:21.285 default S rain_of_fire Fluffy_Pillow 1057654.6/1100000: 96% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
3:22.042 default K conflagrate Fluffy_Pillow 1068545.9/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
3:22.799 default F immolate Fluffy_Pillow_Pack_Beast6 1079437.1/1100000: 98% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact
3:23.556 default F immolate Fluffy_Pillow_Heavy_Spear1 1024335.9/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
3:24.311 default F immolate Fluffy_Pillow_Heavy_Spear2 969361.0/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
3:25.064 default C havoc Fluffy_Pillow_Heavy_Spear2 914356.8/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
3:25.818 default K conflagrate Fluffy_Pillow 837367.3/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
3:26.573 default R channel_demonfire Fluffy_Pillow 848392.4/1100000: 77% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:28.276 default U chaos_bolt Fluffy_Pillow 820460.8/1100000: 75% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:29.767 default K conflagrate Fluffy_Pillow 842514.6/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:31.084 default U chaos_bolt Fluffy_Pillow 862030.3/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:32.663 default V incinerate Fluffy_Pillow 885428.4/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:34.241 default V incinerate Fluffy_Pillow 842811.7/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:35.821 default E immolate Fluffy_Pillow 800095.4/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
3:37.176 default F immolate Fluffy_Pillow_Heavy_Spear2 753591.2/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:38.512 default F immolate Fluffy_Pillow_Heavy_Spear1 707100.5/1100000: 64% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:39.266 default R channel_demonfire Fluffy_Pillow 652113.5/1100000: 59% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:40.950 default L life_tap Fluffy_Pillow 624588.4/1100000: 57% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:41.705 default U chaos_bolt Fluffy_Pillow 965938.7/1100000: 88% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:43.152 default U chaos_bolt Fluffy_Pillow 987692.4/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:44.021 default V incinerate Fluffy_Pillow 1000756.6/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:44.890 default C havoc Fluffy_Pillow_Heavy_Spear1 947820.8/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:45.798 default G immolate Fluffy_Pillow 873781.6/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
3:46.553 default J conflagrate Fluffy_Pillow 819457.4/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
3:47.308 default T dimensional_rift Fluffy_Pillow 831133.1/1100000: 76% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
3:48.063 default U chaos_bolt Fluffy_Pillow 842808.8/1100000: 77% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(5)
3:49.469 default U chaos_bolt Fluffy_Pillow 864232.0/1100000: 79% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:50.377 default K conflagrate Fluffy_Pillow 877295.8/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:51.133 default F immolate Fluffy_Pillow_Pack_Beast6 888172.7/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:52.488 default F immolate Fluffy_Pillow_Pack_Beast5 841667.6/1100000: 77% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:53.845 default K conflagrate Fluffy_Pillow 861191.4/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:55.202 default F immolate Fluffy_Pillow_Heavy_Spear2 880715.1/1100000: 80% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due
3:56.556 default F immolate Fluffy_Pillow_Heavy_Spear1 834196.3/1100000: 76% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:57.892 default R channel_demonfire Fluffy_Pillow 787705.5/1100000: 72% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
4:00.825 default L life_tap Fluffy_Pillow 777947.9/1100000: 71% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:01.936 default U chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:04.137 default U chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:05.440 default C havoc Fluffy_Pillow_Heavy_Spear2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:06.525 default J conflagrate Fluffy_Pillow 1028545.4/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:07.604 default U chaos_bolt Fluffy_Pillow 1045100.5/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
4:08.887 default E immolate Fluffy_Pillow 1064581.8/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:10.037 default Q soul_harvest Fluffy_Pillow 1015127.3/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:10.037 default R channel_demonfire Fluffy_Pillow 1015127.3/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos
4:12.617 default G immolate Fluffy_Pillow 999904.1/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:13.752 default J conflagrate Fluffy_Pillow 950478.2/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando
4:14.886 default K conflagrate Fluffy_Pillow 967037.7/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
4:16.018 default F immolate Fluffy_Pillow_Heavy_Spear1 983568.0/1100000: 89% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando
4:17.153 default F immolate Fluffy_Pillow_Pack_Beast1 934142.1/1100000: 85% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando
4:18.288 default F immolate Fluffy_Pillow_Pack_Beast2 884716.1/1100000: 80% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando
4:19.423 default F immolate Fluffy_Pillow_Pack_Beast3 835359.2/1100000: 76% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:20.541 default F immolate Fluffy_Pillow_Pack_Beast4 785926.1/1100000: 71% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:21.658 default L life_tap Fluffy_Pillow 736541.9/1100000: 67% mana | 5.0/5: 100% soul_shard soul_harvest, lord_of_flames, accelerando(3)
4:22.771 default R channel_demonfire Fluffy_Pillow 1083094.7/1100000: 98% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:25.349 default C havoc Fluffy_Pillow_Heavy_Spear2 1067809.6/1100000: 97% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando
4:26.574 default J conflagrate Fluffy_Pillow 997697.9/1100000: 91% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando
4:27.692 default U chaos_bolt Fluffy_Pillow 1014264.8/1100000: 92% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:29.923 default J conflagrate Fluffy_Pillow 1047324.5/1100000: 95% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:31.042 default J conflagrate Fluffy_Pillow 1063906.2/1100000: 97% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:32.159 default T dimensional_rift Fluffy_Pillow 1080458.2/1100000: 98% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:33.262 default U chaos_bolt Fluffy_Pillow 1097040.3/1100000: 100% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:34.583 default J conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:35.699 default E immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:36.851 default F immolate Fluffy_Pillow_Heavy_Spear1 1034087.6/1100000: 94% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:37.983 default F immolate Fluffy_Pillow_Heavy_Spear2 984617.9/1100000: 90% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:39.116 default G immolate Fluffy_Pillow 935162.8/1100000: 85% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:40.250 default M service_imp Fluffy_Pillow 885722.3/1100000: 81% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:41.383 default J conflagrate Fluffy_Pillow 902267.1/1100000: 82% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:42.517 default L life_tap Fluffy_Pillow 918826.6/1100000: 84% mana | 5.0/5: 100% soul_shard lord_of_flames, accelerando
4:43.650 default R channel_demonfire Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:46.151 default F immolate Fluffy_Pillow_Pack_Beast1 1083721.4/1100000: 99% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:47.286 default F immolate Fluffy_Pillow_Pack_Beast2 1034088.9/1100000: 94% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:48.404 default F immolate Fluffy_Pillow_Pack_Beast3 984655.8/1100000: 90% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:49.541 default F immolate Fluffy_Pillow_Pack_Beast4 935204.3/1100000: 85% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
4:50.691 default F immolate Fluffy_Pillow_Pack_Beast6 885797.6/1100000: 81% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:51.824 default F immolate Fluffy_Pillow_Pack_Beast5 836342.5/1100000: 76% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:52.958 default J conflagrate Fluffy_Pillow 786902.0/1100000: 72% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:54.091 default J conflagrate Fluffy_Pillow 803454.0/1100000: 73% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:55.434 default C havoc Fluffy_Pillow_Heavy_Spear2 823355.0/1100000: 75% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:56.552 default F immolate Fluffy_Pillow_Heavy_Spear2 751921.9/1100000: 68% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:57.669 default F immolate Fluffy_Pillow_Heavy_Spear1 702473.9/1100000: 64% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:58.786 default R channel_demonfire Fluffy_Pillow 653026.0/1100000: 59% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
5:01.207 default J conflagrate Fluffy_Pillow 636101.2/1100000: 58% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51868 51868 33640
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3112080 3112080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 13.94% 13.94% 3577
Haste 30.79% 29.79% 11173
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14387 14277 0
Mastery 67.65% 67.65% 5819
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 905.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="RB/ELT/SH/Serv/CDF"
level=110
race=troll
role=spell
position=back
talents=2303022
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=904.60
# gear_stamina=33640
# gear_intellect=38456
# gear_crit_rating=3577
# gear_haste_rating=11173
# gear_mastery_rating=5819
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Simulation & Raid Information

Iterations: 10003
Threads: 4
Confidence: 95.00%
Fight Length: 215 - 376 ( 300.8 )

Performance:

Total Events Processed: 455424795
Max Event Queue: 505
Sim Seconds: 3008672
CPU Seconds: 442.9531
Physical Seconds: 174.2489
Speed Up: 6792

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.83sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF channel_demonfire 196447 0 0 0.00 0 0 21.6 0.0 0.0% 0.0% 0.0% 0.0% 14.09sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF channel_demonfire_tick 196448 31039451 103198 132.64 40965 81949 0.0 664.9 13.9% 0.0% 0.0% 0.0% 0.00sec 31039451 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF chaos_bolt 116858 41871227 139210 10.67 0 782801 43.5 53.5 100.0% 0.0% 0.0% 0.0% 6.74sec 41871227 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF conflagrate 17962 15214421 50584 9.19 195986 442445 36.5 46.1 54.5% 0.0% 0.0% 0.0% 8.28sec 15214421 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF deadly_grace 188091 2413721 8025 4.00 105734 211728 20.4 20.0 13.9% 0.0% 0.0% 0.0% 1.47sec 2413721 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF demonic_power 196100 35642942 118503 89.65 69593 139186 144.8 449.4 14.0% 0.0% 0.0% 0.0% 2.07sec 35642942 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF dimensional_rift 196586 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 35.65sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF grimoire_of_sacrifice 108503 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF havoc 80240 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 28.35sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF immolate 348 22228673 73904 22.57 134610 269293 104.2 113.2 45.9% 0.0% 0.0% 0.0% 2.86sec 65287113 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF immolate ticks -348 43058441 143528 81.10 72791 145527 104.2 405.5 45.9% 0.0% 0.0% 0.0% 2.86sec 65287113 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF incinerate 29722 3822543 12709 2.95 226808 453599 13.2 14.8 14.0% 0.0% 0.0% 0.0% 21.61sec 3822543 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF life_tap 1454 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 21.21sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF mark_of_the_hidden_satyr 191259 2865262 9526 4.04 124241 248649 20.2 20.2 13.9% 0.0% 0.0% 0.0% 14.83sec 2865262 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF rain_of_fire ticks -5740 5498445 18328 0.00 46811 93653 3.9 0.0 13.9% 0.0% 0.0% 0.0% 43.41sec 5498445 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF soul_harvest 196098 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.98sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF summon_infernal 1122 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.98sec 0 300.78sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF_infernal immolation ticks -19483 6637830 22126 8.01 36598 73185 2.1 40.0 13.9% 0.0% 0.0% 0.0% 180.98sec 6637830 50.27sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF_infernal melee 0 1010897 20111 47.79 22158 44287 40.0 40.0 14.0% 0.0% 0.0% 0.0% 5.44sec 1486115 50.27sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF_lord_of_flames_infernal immolation ticks -19483 4041658 13472 4.56 38240 76492 1.0 22.8 13.9% 0.0% 0.0% 0.0% 0.00sec 4041658 25.00sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF_lord_of_flames_infernal melee 0 608000 24319 54.77 23386 46763 22.8 22.8 13.9% 0.0% 0.0% 0.0% 1.08sec 893818 25.00sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF_lord_of_flames_infernal immolation ticks -19483 4045330 13484 4.56 38242 76466 1.0 22.8 14.0% 0.0% 0.0% 0.0% 0.00sec 4045330 25.00sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF_lord_of_flames_infernal melee 0 608334 24332 54.77 23384 46787 22.8 22.8 14.0% 0.0% 0.0% 0.0% 1.08sec 894308 25.00sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF_lord_of_flames_infernal immolation ticks -19483 4043709 13479 4.56 38243 76456 1.0 22.8 13.9% 0.0% 0.0% 0.0% 0.00sec 4043709 25.00sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF_lord_of_flames_infernal melee 0 607598 24303 54.77 23384 46779 22.8 22.8 13.9% 0.0% 0.0% 0.0% 1.08sec 893227 25.00sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF_shadowy_tear shadow_bolt ticks -196657 4507055 15024 7.32 108138 216050 3.3 36.6 13.9% 0.0% 0.0% 0.0% 78.63sec 4507055 40.27sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF_chaos_tear chaos_bolt 215279 2081363 132825 12.63 0 631020 3.3 3.3 100.0% 0.0% 0.0% 0.0% 77.45sec 2081363 15.67sec
BD/ELT/SH/Sac/CDF BD/ELT/SH/Sac/CDF_chaos_portal chaos_barrage ticks -187394 4014683 13382 23.01 30639 61265 3.3 115.0 13.9% 0.0% 0.0% 0.0% 79.21sec 4014683 16.87sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.49sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC chaos_bolt 116858 64226468 213535 16.38 0 781987 65.2 82.1 100.0% 0.0% 0.0% 0.0% 4.51sec 64226468 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC conflagrate 17962 19960161 66362 11.89 196281 441830 47.2 59.6 56.4% 0.0% 0.0% 0.0% 6.39sec 19960161 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC deadly_grace 188091 2397843 7972 3.98 105559 211291 20.2 20.0 13.8% 0.0% 0.0% 0.0% 1.48sec 2397843 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC demonic_power 196100 35751350 118863 89.98 69560 139124 143.5 451.1 13.9% 0.0% 0.0% 0.0% 2.09sec 35751350 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC dimensional_rift 196586 0 0 0.00 0 0 10.4 0.0 0.0% 0.0% 0.0% 0.0% 33.09sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC grimoire_of_sacrifice 108503 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC havoc 80240 0 0 0.00 0 0 10.8 0.0 0.0% 0.0% 0.0% 0.0% 28.26sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC immolate 348 22517898 74866 22.87 134568 269062 105.8 114.6 46.0% 0.0% 0.0% 0.0% 2.82sec 66342449 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC immolate ticks -348 43824551 146082 82.32 72966 145885 105.8 411.6 46.0% 0.0% 0.0% 0.0% 2.82sec 66342449 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC incinerate 29722 7914008 26312 6.10 227132 454140 26.6 30.6 14.0% 0.0% 0.0% 0.0% 10.88sec 7914008 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC life_tap 1454 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.09sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC mark_of_the_hidden_satyr 191259 2852076 9482 4.02 124189 248343 20.2 20.2 13.9% 0.0% 0.0% 0.0% 14.90sec 2852076 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC rain_of_fire ticks -5740 10237732 34126 0.00 46905 93811 8.1 0.0 14.0% 0.0% 0.0% 0.0% 28.21sec 10237732 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC soul_harvest 196098 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.67sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC summon_infernal 1122 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.61sec 0 300.78sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC_infernal immolation ticks -19483 6641823 22139 8.02 36595 73180 2.1 40.1 14.0% 0.0% 0.0% 0.0% 180.61sec 6641823 50.32sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC_infernal melee 0 1011667 20105 47.79 22161 44290 40.1 40.1 13.9% 0.0% 0.0% 0.0% 5.48sec 1487246 50.32sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC_lord_of_flames_infernal immolation ticks -19483 4040791 13469 4.57 38238 76426 1.0 22.8 13.9% 0.0% 0.0% 0.0% 0.00sec 4040791 25.00sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC_lord_of_flames_infernal melee 0 607867 24314 54.78 23380 46817 22.8 22.8 13.9% 0.0% 0.0% 0.0% 1.08sec 893622 25.00sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC_lord_of_flames_infernal immolation ticks -19483 4042205 13474 4.57 38233 76489 1.0 22.8 13.9% 0.0% 0.0% 0.0% 0.00sec 4042205 25.00sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC_lord_of_flames_infernal melee 0 608422 24336 54.78 23383 46770 22.8 22.8 14.0% 0.0% 0.0% 0.0% 1.08sec 894437 25.00sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC_lord_of_flames_infernal immolation ticks -19483 4041981 13473 4.57 38235 76466 1.0 22.8 13.9% 0.0% 0.0% 0.0% 0.00sec 4041981 25.00sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC_lord_of_flames_infernal melee 0 608235 24328 54.78 23383 46773 22.8 22.8 13.9% 0.0% 0.0% 0.0% 1.08sec 894163 25.00sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC_shadowy_tear shadow_bolt ticks -196657 4833356 16111 7.85 108172 215922 3.6 39.3 13.8% 0.0% 0.0% 0.0% 75.39sec 4833356 42.83sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC_chaos_tear chaos_bolt 215279 2215234 139570 13.26 0 631422 3.5 3.5 100.0% 0.0% 0.0% 0.0% 71.51sec 2215234 15.87sec
BD/ELT/SH/Sac/SC BD/ELT/SH/Sac/SC_chaos_portal chaos_barrage ticks -187394 4270092 14234 24.49 30625 61209 3.6 122.4 13.9% 0.0% 0.0% 0.0% 77.31sec 4270092 17.58sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.68sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH chaos_bolt 116858 60043682 199629 15.35 0 780555 48.0 76.9 100.0% 0.0% 0.0% 0.0% 6.14sec 60043682 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH conflagrate 17962 25799898 85778 15.36 196854 442680 48.1 77.0 56.2% 0.0% 0.0% 0.0% 6.27sec 25799898 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH deadly_grace 188091 2407429 8004 3.95 106720 213331 20.1 19.8 13.9% 0.0% 0.0% 0.0% 1.49sec 2407429 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH demonic_power 196100 32398993 107718 80.24 70694 141370 142.0 402.2 13.9% 0.0% 0.0% 0.0% 2.11sec 32398993 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH dimensional_rift 196586 0 0 0.00 0 0 11.7 0.0 0.0% 0.0% 0.0% 0.0% 28.73sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH grimoire_of_sacrifice 108503 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH havoc 80240 0 0 0.00 0 0 38.1 0.0 0.0% 0.0% 0.0% 0.0% 7.55sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH immolate 348 16800030 55855 16.77 136854 273806 65.1 84.0 46.0% 0.0% 0.0% 0.0% 4.57sec 49084130 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH immolate ticks -348 32284099 107614 59.97 73792 147625 65.1 299.9 45.9% 0.0% 0.0% 0.0% 4.57sec 49084130 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH incinerate 29722 18989766 63136 14.83 224077 448543 50.3 74.4 14.0% 0.0% 0.0% 0.0% 5.86sec 18989766 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH life_tap 1454 0 0 0.00 0 0 17.7 0.0 0.0% 0.0% 0.0% 0.0% 17.21sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH mark_of_the_hidden_satyr 191259 2865191 9526 4.02 124843 249747 20.1 20.1 14.0% 0.0% 0.0% 0.0% 14.89sec 2865191 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH rain_of_fire ticks -5740 14156035 47187 0.00 47860 95653 6.1 0.0 14.0% 0.0% 0.0% 0.0% 42.00sec 14156035 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH soul_harvest 196098 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.55sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH summon_doomguard 18540 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH summon_infernal 1122 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 300.78sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_infernal immolation ticks -19483 6635016 22117 8.01 36593 73195 2.1 40.0 13.9% 0.0% 0.0% 0.0% 181.02sec 6635016 50.27sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_infernal melee 0 1010689 20104 47.79 22162 44291 40.0 40.0 13.9% 0.0% 0.0% 0.0% 5.46sec 1485809 50.27sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_doomguard doom_bolt 85692 2126788 85068 26.40 181003 362007 11.0 11.0 6.8% 0.0% 0.0% 0.0% 2.15sec 2126788 25.00sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_lord_of_flames_infernal immolation ticks -19483 4042797 13476 4.57 38233 76449 1.0 22.8 14.0% 0.0% 0.0% 0.0% 0.00sec 4042797 25.00sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_lord_of_flames_infernal melee 0 607860 24313 54.78 23381 46797 22.8 22.8 13.9% 0.0% 0.0% 0.0% 1.08sec 893612 25.00sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_lord_of_flames_infernal immolation ticks -19483 4041336 13471 4.57 38231 76465 1.0 22.8 13.9% 0.0% 0.0% 0.0% 0.00sec 4041336 25.00sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_lord_of_flames_infernal melee 0 608639 24345 54.78 23381 46799 22.8 22.8 14.0% 0.0% 0.0% 0.0% 1.08sec 894757 25.00sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_lord_of_flames_infernal immolation ticks -19483 4041233 13471 4.57 38231 76467 1.0 22.8 13.9% 0.0% 0.0% 0.0% 0.00sec 4041233 25.00sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_lord_of_flames_infernal melee 0 608677 24346 54.78 23384 46760 22.8 22.8 14.0% 0.0% 0.0% 0.0% 1.08sec 894813 25.00sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_shadowy_tear shadow_bolt ticks -196657 5270815 17569 8.61 107388 214737 3.9 43.1 14.0% 0.0% 0.0% 0.0% 68.78sec 5270815 47.06sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_chaos_tear chaos_bolt 215279 2498817 139920 13.23 0 634667 3.9 3.9 100.0% 0.0% 0.0% 0.0% 65.78sec 2498817 17.86sec
BD/ELT/SH/Sac/WH BD/ELT/SH/Sac/WH_chaos_portal chaos_barrage ticks -187394 4698779 15663 26.87 30696 61395 3.9 134.4 13.9% 0.0% 0.0% 0.0% 69.23sec 4698779 19.54sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.76sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF channel_demonfire 196447 0 0 0.00 0 0 21.9 0.0 0.0% 0.0% 0.0% 0.0% 13.77sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF channel_demonfire_tick 196448 38127131 126762 173.98 38355 76777 0.0 872.2 14.0% 0.0% 0.0% 0.0% 0.00sec 38127131 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF chaos_bolt 116858 35790801 118994 9.14 0 780810 36.3 45.8 100.0% 0.0% 0.0% 0.0% 7.97sec 35790801 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF conflagrate 17962 19988936 66458 12.11 194204 435989 48.5 60.7 55.8% 0.0% 0.0% 0.0% 6.19sec 19988936 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF deadly_grace 188091 2416753 8035 3.99 105845 211575 20.2 20.0 14.0% 0.0% 0.0% 0.0% 1.48sec 2416753 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF demonic_power 196100 36335174 120804 91.09 69830 139669 141.5 456.6 13.9% 0.0% 0.0% 0.0% 2.12sec 36335174 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF dimensional_rift 196586 0 0 0.00 0 0 9.2 0.0 0.0% 0.0% 0.0% 0.0% 37.76sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF grimoire_of_sacrifice 108503 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF havoc 80240 0 0 0.00 0 0 10.8 0.0 0.0% 0.0% 0.0% 0.0% 28.17sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF immolate 348 19412247 64540 19.76 134335 268580 90.8 99.0 45.9% 0.0% 0.0% 0.0% 3.27sec 72324480 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF immolate ticks -348 52912232 176374 69.14 104858 209774 90.8 345.7 45.9% 0.0% 0.0% 0.0% 3.27sec 72324480 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF incinerate 29722 1172986 3900 0.93 220015 439769 4.1 4.7 14.2% 0.0% 0.0% 0.0% 36.73sec 1172986 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF life_tap 1454 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.92sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF mark_of_the_hidden_satyr 191259 2850165 9476 4.03 123855 247712 20.2 20.2 14.0% 0.0% 0.0% 0.0% 14.77sec 2850165 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF rain_of_fire ticks -5740 12385153 41284 0.00 46967 93872 6.7 0.0 13.9% 0.0% 0.0% 0.0% 30.50sec 12385153 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.49sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF summon_doomguard 18540 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF summon_infernal 1122 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.58sec 0 300.78sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_infernal immolation ticks -19483 6868521 22895 7.87 37326 74629 2.0 39.3 13.9% 0.0% 0.0% 0.0% 181.58sec 6868521 50.09sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_infernal melee 0 993749 19841 47.13 22172 44338 39.3 39.3 13.9% 0.0% 0.0% 0.0% 5.45sec 1460905 50.09sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_doomguard doom_bolt 85692 1416084 93894 25.74 181003 362007 6.5 6.5 20.9% 0.0% 0.0% 0.0% 2.20sec 1416084 15.08sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_lord_of_flames_infernal immolation ticks -19483 4319592 14399 4.46 39388 78785 1.0 22.3 13.9% 0.0% 0.0% 0.0% 0.00sec 4319592 25.00sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_lord_of_flames_infernal melee 0 595953 23837 53.50 23446 46878 22.3 22.3 14.0% 0.0% 0.0% 0.0% 1.09sec 876107 25.00sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_lord_of_flames_infernal immolation ticks -19483 4320946 14403 4.46 39387 78796 1.0 22.3 14.0% 0.0% 0.0% 0.0% 0.00sec 4320946 25.00sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_lord_of_flames_infernal melee 0 596080 23842 53.50 23445 46887 22.3 22.3 14.0% 0.0% 0.0% 0.0% 1.09sec 876294 25.00sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_lord_of_flames_infernal immolation ticks -19483 4320015 14400 4.46 39390 78768 1.0 22.3 14.0% 0.0% 0.0% 0.0% 0.00sec 4320015 25.00sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_lord_of_flames_infernal melee 0 594921 23796 53.50 23444 46899 22.3 22.3 13.8% 0.0% 0.0% 0.0% 1.09sec 874590 25.00sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_shadowy_tear shadow_bolt ticks -196657 4234049 14113 6.86 108362 216635 3.2 34.3 14.0% 0.0% 0.0% 0.0% 82.61sec 4234049 38.36sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_chaos_tear chaos_bolt 215279 1969205 131211 12.48 0 630737 3.1 3.1 100.0% 0.0% 0.0% 0.0% 80.35sec 1969205 15.01sec
RB/ELT/SH/Sac/CDF RB/ELT/SH/Sac/CDF_chaos_portal chaos_barrage ticks -187394 3712283 12374 21.48 30329 60662 3.2 107.4 14.0% 0.0% 0.0% 0.0% 84.24sec 3712283 16.45sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.70sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC chaos_bolt 116858 54992889 182836 14.01 0 783244 55.9 70.2 100.0% 0.0% 0.0% 0.0% 5.22sec 54992889 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC conflagrate 17962 20227739 67252 12.26 194498 436827 48.7 61.5 55.6% 0.0% 0.0% 0.0% 6.17sec 20227739 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC deadly_grace 188091 2404240 7993 3.99 105431 211176 20.3 20.0 13.9% 0.0% 0.0% 0.0% 1.48sec 2404240 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC demonic_power 196100 36775688 122269 92.13 69883 139762 140.6 461.9 13.9% 0.0% 0.0% 0.0% 2.13sec 36775688 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC dimensional_rift 196586 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 35.82sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC grimoire_of_sacrifice 108503 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC havoc 80240 0 0 0.00 0 0 10.8 0.0 0.0% 0.0% 0.0% 0.0% 28.18sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC immolate 348 21692370 72121 22.00 134717 269556 101.5 110.3 46.0% 0.0% 0.0% 0.0% 2.92sec 80129117 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC immolate ticks -348 58436748 194789 76.62 104560 209033 101.5 383.1 45.9% 0.0% 0.0% 0.0% 2.92sec 80129117 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC incinerate 29722 4230097 14064 3.33 222076 445105 12.7 16.7 13.9% 0.0% 0.0% 0.0% 20.66sec 4230097 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC life_tap 1454 0 0 0.00 0 0 14.3 0.0 0.0% 0.0% 0.0% 0.0% 21.50sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC mark_of_the_hidden_satyr 191259 2839199 9440 4.01 124048 247989 20.1 20.1 13.9% 0.0% 0.0% 0.0% 14.93sec 2839199 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC rain_of_fire ticks -5740 15586001 51953 0.00 47040 94072 11.4 0.0 14.0% 0.0% 0.0% 0.0% 20.19sec 15586001 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.23sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC summon_doomguard 18540 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC summon_infernal 1122 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.36sec 0 300.78sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_infernal immolation ticks -19483 6879421 22931 7.87 37317 74599 2.0 39.4 13.9% 0.0% 0.0% 0.0% 181.36sec 6879421 50.11sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_infernal melee 0 994793 19853 47.15 22171 44345 39.4 39.4 14.0% 0.0% 0.0% 0.0% 5.47sec 1462439 50.11sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_doomguard doom_bolt 85692 1905059 85797 26.35 181506 362007 9.8 9.8 7.7% 0.0% 0.0% 0.0% 2.24sec 1905059 22.20sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_lord_of_flames_infernal immolation ticks -19483 4318915 14396 4.46 39377 78755 1.0 22.3 13.9% 0.0% 0.0% 0.0% 0.00sec 4318915 25.00sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_lord_of_flames_infernal melee 0 596270 23850 53.54 23442 46878 22.3 22.3 14.0% 0.0% 0.0% 0.0% 1.09sec 876573 25.00sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_lord_of_flames_infernal immolation ticks -19483 4319986 14400 4.46 39376 78772 1.0 22.3 14.0% 0.0% 0.0% 0.0% 0.00sec 4319986 25.00sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_lord_of_flames_infernal melee 0 595338 23813 53.54 23444 46859 22.3 22.3 13.9% 0.0% 0.0% 0.0% 1.09sec 875203 25.00sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_lord_of_flames_infernal immolation ticks -19483 4317799 14393 4.46 39376 78771 1.0 22.3 13.9% 0.0% 0.0% 0.0% 0.00sec 4317799 25.00sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_lord_of_flames_infernal melee 0 595757 23829 53.54 23444 46862 22.3 22.3 13.9% 0.0% 0.0% 0.0% 1.09sec 875820 25.00sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_shadowy_tear shadow_bolt ticks -196657 4436112 14787 7.26 107349 214299 3.3 36.3 13.8% 0.0% 0.0% 0.0% 80.27sec 4436112 40.11sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_chaos_tear chaos_bolt 215279 2089440 132009 12.52 0 632512 3.3 3.3 100.0% 0.0% 0.0% 0.0% 74.97sec 2089440 15.83sec
RB/ELT/SH/Sac/SC RB/ELT/SH/Sac/SC_chaos_portal chaos_barrage ticks -187394 3941062 13137 22.75 30415 60840 3.3 113.7 13.9% 0.0% 0.0% 0.0% 80.17sec 3941062 17.21sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.77sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH chaos_bolt 116858 49994929 166219 12.79 0 779766 39.5 64.1 100.0% 0.0% 0.0% 0.0% 7.42sec 49994929 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH conflagrate 17962 24339084 80921 14.80 194626 436393 48.1 74.2 55.2% 0.0% 0.0% 0.0% 6.25sec 24339084 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH deadly_grace 188091 2424607 8061 3.97 106830 213508 20.2 19.9 14.0% 0.0% 0.0% 0.0% 1.48sec 2424607 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH demonic_power 196100 34292395 114013 84.73 70861 141703 139.5 424.8 13.9% 0.0% 0.0% 0.0% 2.15sec 34292395 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH dimensional_rift 196586 0 0 0.00 0 0 10.9 0.0 0.0% 0.0% 0.0% 0.0% 31.31sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH grimoire_of_sacrifice 108503 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH havoc 80240 0 0 0.00 0 0 42.1 0.0 0.0% 0.0% 0.0% 0.0% 6.81sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH immolate 348 15338253 50995 15.40 136170 272251 61.2 77.2 46.0% 0.0% 0.0% 0.0% 4.87sec 62636621 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH immolate ticks -348 47298368 157661 55.36 117085 234133 61.2 276.8 46.0% 0.0% 0.0% 0.0% 4.87sec 62636621 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH incinerate 29722 13681205 45486 10.70 223929 448053 35.2 53.6 13.9% 0.0% 0.0% 0.0% 7.97sec 13681205 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH life_tap 1454 0 0 0.00 0 0 15.7 0.0 0.0% 0.0% 0.0% 0.0% 19.77sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH mark_of_the_hidden_satyr 191259 2867125 9532 4.03 124500 248917 20.2 20.2 14.0% 0.0% 0.0% 0.0% 14.75sec 2867125 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH rain_of_fire ticks -5740 21082143 70274 0.00 47884 95746 8.7 0.0 13.9% 0.0% 0.0% 0.0% 29.76sec 21082143 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.16sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH summon_doomguard 18540 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH summon_infernal 1122 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.76sec 0 300.78sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_infernal immolation ticks -19483 6840453 22802 7.83 37343 74688 2.0 39.2 13.9% 0.0% 0.0% 0.0% 181.76sec 6840453 49.91sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_infernal melee 0 989173 19819 47.08 22181 44342 39.2 39.2 13.9% 0.0% 0.0% 0.0% 5.46sec 1454179 49.91sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_doomguard doom_bolt 85692 2106959 89205 26.32 181003 362007 10.4 10.4 12.4% 0.0% 0.0% 0.0% 2.22sec 2106959 23.62sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_lord_of_flames_infernal immolation ticks -19483 4320774 14403 4.45 39393 78772 1.0 22.3 13.9% 0.0% 0.0% 0.0% 0.00sec 4320774 25.00sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_lord_of_flames_infernal melee 0 594857 23793 53.44 23448 46881 22.3 22.3 13.9% 0.0% 0.0% 0.0% 1.09sec 874497 25.00sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_lord_of_flames_infernal immolation ticks -19483 4319673 14399 4.45 39393 78779 1.0 22.3 13.9% 0.0% 0.0% 0.0% 0.00sec 4319673 25.00sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_lord_of_flames_infernal melee 0 594760 23789 53.44 23449 46873 22.3 22.3 13.9% 0.0% 0.0% 0.0% 1.09sec 874353 25.00sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_lord_of_flames_infernal immolation ticks -19483 4323499 14412 4.45 39390 78806 1.0 22.3 14.0% 0.0% 0.0% 0.0% 0.00sec 4323499 25.00sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_lord_of_flames_infernal melee 0 594843 23793 53.44 23448 46881 22.3 22.3 13.9% 0.0% 0.0% 0.0% 1.09sec 874476 25.00sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_shadowy_tear shadow_bolt ticks -196657 4906310 16354 8.06 106897 213593 3.7 40.3 14.0% 0.0% 0.0% 0.0% 72.30sec 4906310 44.46sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_chaos_tear chaos_bolt 215279 2309472 132135 12.50 0 633990 3.6 3.6 100.0% 0.0% 0.0% 0.0% 70.82sec 2309472 17.48sec
RB/ELT/SH/Sac/WH RB/ELT/SH/Sac/WH_chaos_portal chaos_barrage ticks -187394 4384506 14615 25.28 30456 60855 3.7 126.4 13.9% 0.0% 0.0% 0.0% 71.90sec 4384506 19.31sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.78sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF channel_demonfire 196447 0 0 0.00 0 0 21.7 0.0 0.0% 0.0% 0.0% 0.0% 13.84sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF channel_demonfire_tick 196448 38416370 127724 175.44 38328 76675 0.0 879.5 14.0% 0.0% 0.0% 0.0% 0.00sec 38416370 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF chaos_bolt 116858 34425002 114454 8.81 0 779620 34.5 44.2 100.0% 0.0% 0.0% 0.0% 8.29sec 34425002 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF conflagrate 17962 19922339 66236 12.10 193900 435350 48.5 60.6 55.7% 0.0% 0.0% 0.0% 6.19sec 19922339 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF deadly_grace 188091 4111828 13671 6.70 107387 214656 34.0 33.6 14.0% 0.0% 0.0% 0.0% 4.82sec 4111828 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF dimensional_rift 196586 0 0 0.00 0 0 9.2 0.0 0.0% 0.0% 0.0% 0.0% 37.52sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF havoc 80240 0 0 0.00 0 0 10.8 0.0 0.0% 0.0% 0.0% 0.0% 28.22sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF immolate 348 19218011 63895 19.53 134595 269188 89.7 97.9 45.9% 0.0% 0.0% 0.0% 3.32sec 71987202 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF immolate ticks -348 52769190 175897 68.87 104991 210011 89.7 344.3 46.0% 0.0% 0.0% 0.0% 3.32sec 71987202 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF incinerate 29722 1210346 4024 0.96 220540 440876 4.3 4.8 13.7% 0.0% 0.0% 0.0% 37.79sec 1210346 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF life_tap 1454 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.84sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF mark_of_the_hidden_satyr 191259 2848188 9469 4.02 123885 247705 20.2 20.2 14.1% 0.0% 0.0% 0.0% 14.92sec 2848188 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF rain_of_fire ticks -5740 12998687 43329 0.00 47134 94325 6.8 0.0 13.9% 0.0% 0.0% 0.0% 31.61sec 12998687 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.73sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.51sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF summon_doomguard 18540 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF summon_infernal 1122 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.11sec 0 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_imp firebolt 3110 12505733 41578 21.86 100126 200207 109.6 109.6 14.0% 0.0% 0.0% 0.0% 2.74sec 12505733 300.78sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_service_imp firebolt 3110 11350738 118826 30.88 202546 405337 49.2 49.2 14.0% 0.0% 0.0% 0.0% 5.49sec 11350738 95.52sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_infernal immolation ticks -19483 6659817 22199 7.77 37576 75170 2.0 38.8 14.0% 0.0% 0.0% 0.0% 183.11sec 6659817 49.58sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_infernal melee 0 982172 19808 46.99 22190 44382 38.8 38.8 14.0% 0.0% 0.0% 0.0% 5.43sec 1443887 49.58sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_doomguard doom_bolt 85692 2009649 90231 26.32 181044 362263 9.8 9.8 13.6% 0.0% 0.0% 0.0% 2.22sec 2009649 22.27sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_lord_of_flames_infernal immolation ticks -19483 4240663 14136 4.44 39756 79511 1.0 22.2 14.0% 0.0% 0.0% 0.0% 0.00sec 4240663 25.00sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_lord_of_flames_infernal melee 0 593365 23734 53.32 23453 46897 22.2 22.2 13.9% 0.0% 0.0% 0.0% 1.10sec 872303 25.00sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_lord_of_flames_infernal immolation ticks -19483 4238743 14129 4.44 39756 79508 1.0 22.2 13.9% 0.0% 0.0% 0.0% 0.00sec 4238743 25.00sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_lord_of_flames_infernal melee 0 593589 23743 53.32 23453 46904 22.2 22.2 13.9% 0.0% 0.0% 0.0% 1.10sec 872632 25.00sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_lord_of_flames_infernal immolation ticks -19483 4238657 14129 4.44 39755 79519 1.0 22.2 13.9% 0.0% 0.0% 0.0% 0.00sec 4238657 25.00sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_lord_of_flames_infernal melee 0 593572 23742 53.32 23451 46921 22.2 22.2 13.9% 0.0% 0.0% 0.0% 1.10sec 872608 25.00sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_shadowy_tear shadow_bolt ticks -196657 4223168 14077 6.85 108208 216572 3.1 34.3 13.9% 0.0% 0.0% 0.0% 83.03sec 4223168 38.53sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_chaos_tear chaos_bolt 215279 1969784 131630 12.51 0 631397 3.1 3.1 100.0% 0.0% 0.0% 0.0% 77.39sec 1969784 14.96sec
RB/ELT/SH/Serv/CDF RB/ELT/SH/Serv/CDF_chaos_portal chaos_barrage ticks -187394 3706325 12354 21.47 30303 60559 3.2 107.3 14.0% 0.0% 0.0% 0.0% 81.97sec 3706325 16.59sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 12.08% 12.08% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:12.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 11.47% 11.47% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:11.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.38% 11.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.63% 11.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.63%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.57% 11.57% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.57%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 12.04% 12.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:12.04%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.23% 12.23% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 9.14% 9.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:9.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 4.64% 4.64% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 3.82% 3.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:3.82%

Trigger Attempt Success

  • trigger_pct:100.00%
Eradication 16.2 19.4 19.0sec 8.3sec 54.43% 54.43% 19.4(19.4) 15.7

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:54.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.4 41.5 20.1sec 5.2sec 69.12% 69.12% 41.5(41.5) 14.7

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:69.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 16.3 21.0 18.8sec 7.9sec 56.46% 56.46% 21.0(21.0) 15.8

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:56.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 17.0 23.5 18.2sec 7.4sec 59.93% 59.93% 23.5(23.5) 16.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:59.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 13.7 52.5 22.8sec 4.5sec 71.43% 71.43% 52.5(52.5) 12.9

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:71.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.7 28.8 19.7sec 6.7sec 60.01% 60.01% 28.8(28.8) 15.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:60.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 17.2 31.8 18.0sec 6.1sec 70.45% 70.45% 31.8(31.8) 16.4

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:70.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 11.0 37.5 28.6sec 6.2sec 79.30% 77.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:11.63%
  • roaring_blaze_2:14.46%
  • roaring_blaze_3:16.58%
  • roaring_blaze_4:21.57%
  • roaring_blaze_5:13.50%
  • roaring_blaze_6:1.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.8 37.9 29.2sec 6.2sec 78.13% 75.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.50%
  • roaring_blaze_2:11.44%
  • roaring_blaze_3:14.72%
  • roaring_blaze_4:25.68%
  • roaring_blaze_5:14.88%
  • roaring_blaze_6:2.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 11.0 37.5 28.6sec 6.2sec 79.47% 77.29% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:11.56%
  • roaring_blaze_2:14.46%
  • roaring_blaze_3:16.86%
  • roaring_blaze_4:21.67%
  • roaring_blaze_5:13.28%
  • roaring_blaze_6:1.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.8 37.2 29.3sec 6.3sec 74.54% 74.31% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.91%
  • roaring_blaze_2:11.39%
  • roaring_blaze_3:16.84%
  • roaring_blaze_4:19.37%
  • roaring_blaze_5:14.86%
  • roaring_blaze_6:4.17%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 1.2 1.0 0.0sec 0.0sec 20.98% 20.98% 1.0(1.0) 0.7

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:20.98%

Trigger Attempt Success

  • trigger_pct:99.61%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 2.3 2.8 0.0sec 0.0sec 32.71% 32.71% 2.8(2.8) 0.5

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:32.71%

Trigger Attempt Success

  • trigger_pct:99.25%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 1.1 0.7 0.0sec 0.0sec 15.84% 15.84% 0.7(0.7) 0.6

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:15.84%

Trigger Attempt Success

  • trigger_pct:93.46%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 1.5 1.7 0.0sec 0.0sec 24.23% 24.23% 1.7(1.7) 0.7

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:24.23%

Trigger Attempt Success

  • trigger_pct:99.02%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 2.1 2.2 0.0sec 0.0sec 30.53% 30.53% 2.2(2.2) 0.6

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:30.53%

Trigger Attempt Success

  • trigger_pct:99.28%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 1.2 0.8 0.0sec 0.0sec 20.02% 20.02% 0.8(0.8) 0.6

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:20.02%

Trigger Attempt Success

  • trigger_pct:97.10%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 1.4 1.7 0.0sec 0.0sec 23.93% 23.93% 1.7(1.7) 0.8

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:23.93%

Trigger Attempt Success

  • trigger_pct:98.99%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 27.75% 27.75% 0.0(0.0) 1.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 44.73% 44.73% 0.0(0.0) 0.1

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:44.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 27.85% 27.85% 0.0(0.0) 1.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 27.82% 27.82% 0.0(0.0) 1.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 44.86% 44.86% 0.0(0.0) 0.1

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:44.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 27.36% 27.36% 0.0(0.0) 1.2

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 27.55% 27.55% 0.0(0.0) 1.3

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Roaring Blaze 2.4 0.2 0.0sec 0.0sec 31.74% 54.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:29.68%
  • roaring_blaze_2:1.74%
  • roaring_blaze_3:0.33%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:99.73%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Roaring Blaze 1.9 0.2 0.0sec 0.0sec 23.15% 45.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:21.41%
  • roaring_blaze_2:1.54%
  • roaring_blaze_3:0.20%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:97.59%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Roaring Blaze 2.9 0.7 0.0sec 0.0sec 34.20% 80.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:30.62%
  • roaring_blaze_2:2.76%
  • roaring_blaze_3:0.61%
  • roaring_blaze_4:0.20%
  • roaring_blaze_5:0.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Roaring Blaze 1.8 0.1 0.0sec 0.0sec 19.33% 38.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:18.38%
  • roaring_blaze_2:0.76%
  • roaring_blaze_3:0.21%

Trigger Attempt Success

  • trigger_pct:95.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 1.6 1.2 0.0sec 0.0sec 5.74% 5.74% 1.2(1.2) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:5.74%

Trigger Attempt Success

  • trigger_pct:92.89%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 1.8 2.2 0.0sec 0.0sec 7.25% 7.25% 2.2(2.2) 1.1

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:7.25%

Trigger Attempt Success

  • trigger_pct:95.87%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 1.6 1.3 0.0sec 0.0sec 6.01% 6.01% 1.3(1.3) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:6.01%

Trigger Attempt Success

  • trigger_pct:95.23%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 4.3 4.7 0.0sec 0.0sec 13.91% 13.91% 4.7(4.7) 1.2

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:13.91%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 1.9 2.0 0.0sec 0.0sec 7.26% 7.26% 2.0(2.0) 1.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:7.26%

Trigger Attempt Success

  • trigger_pct:96.02%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 1.5 1.1 0.0sec 0.0sec 5.11% 5.11% 1.1(1.1) 0.7

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:5.11%

Trigger Attempt Success

  • trigger_pct:89.49%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 5.3 4.9 0.0sec 0.0sec 15.67% 15.67% 4.9(4.9) 1.9

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:15.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Havoc 2.1 0.0 0.0sec 0.0sec 7.63% 7.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:7.63%

Trigger Attempt Success

  • trigger_pct:97.50%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.1 0.0 0.0sec 0.0sec 7.75% 7.75% 0.0(0.0) 2.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:7.75%

Trigger Attempt Success

  • trigger_pct:96.63%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.3 0.0 0.0sec 0.0sec 15.01% 15.01% 0.0(0.0) 0.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:15.01%

Trigger Attempt Success

  • trigger_pct:98.24%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.0 0.0 0.0sec 0.0sec 7.36% 7.36% 0.0(0.0) 1.9

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:7.36%

Trigger Attempt Success

  • trigger_pct:97.43%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.0 0.0 0.0sec 0.0sec 7.33% 7.33% 0.0(0.0) 1.9

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:7.33%

Trigger Attempt Success

  • trigger_pct:97.12%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.0 0.0 0.0sec 0.0sec 7.45% 7.45% 0.0(0.0) 1.9

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:7.45%

Trigger Attempt Success

  • trigger_pct:97.95%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.0 0.0 0.0sec 0.0sec 13.39% 13.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:13.39%

Trigger Attempt Success

  • trigger_pct:97.47%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Roaring Blaze 1.6 0.7 0.0sec 0.0sec 7.09% 14.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:4.94%
  • roaring_blaze_2:1.70%
  • roaring_blaze_3:0.45%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:88.81%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Roaring Blaze 1.6 0.7 0.0sec 0.0sec 7.01% 14.19% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:4.91%
  • roaring_blaze_2:1.67%
  • roaring_blaze_3:0.43%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:88.49%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Roaring Blaze 4.3 3.6 0.0sec 0.0sec 11.00% 27.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:5.62%
  • roaring_blaze_2:4.19%
  • roaring_blaze_3:0.96%
  • roaring_blaze_4:0.23%
  • roaring_blaze_5:0.00%

Trigger Attempt Success

  • trigger_pct:99.86%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Roaring Blaze 1.7 1.1 0.0sec 0.0sec 8.19% 14.94% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:4.52%
  • roaring_blaze_2:3.05%
  • roaring_blaze_3:0.62%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:94.53%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 2.6 1.1 0.0sec 0.0sec 6.85% 6.85% 1.1(1.1) 1.4

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:6.85%

Trigger Attempt Success

  • trigger_pct:96.13%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 5.4 4.9 0.0sec 0.0sec 11.98% 11.98% 4.9(4.9) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:11.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 5.2 3.6 0.0sec 0.0sec 11.32% 11.32% 3.6(3.6) 1.6

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:11.32%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 5.5 7.1 0.0sec 0.0sec 13.33% 13.33% 7.1(7.1) 0.7

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 2.7 1.9 0.0sec 0.0sec 7.20% 7.20% 1.9(1.9) 0.9

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:7.20%

Trigger Attempt Success

  • trigger_pct:96.41%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 2.6 1.1 0.0sec 0.0sec 6.89% 6.89% 1.1(1.1) 1.4

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:6.89%

Trigger Attempt Success

  • trigger_pct:96.20%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 4.4 1.9 0.0sec 0.0sec 9.82% 9.82% 1.9(1.9) 1.9

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:9.82%

Trigger Attempt Success

  • trigger_pct:99.69%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Havoc 6.6 0.0 0.0sec 0.0sec 26.91% 26.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:26.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 6.8 0.0 0.0sec 0.0sec 18.79% 18.79% 0.0(0.0) 3.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:18.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 6.9 0.0 0.0sec 0.0sec 19.08% 19.08% 0.0(0.0) 3.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:19.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 6.9 0.0 0.0sec 0.0sec 27.74% 27.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 7.0 0.0 0.0sec 0.0sec 19.19% 19.19% 0.0(0.0) 3.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:19.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 7.0 0.0 0.0sec 0.0sec 19.53% 19.53% 0.0(0.0) 3.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:19.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 7.0 0.0 0.0sec 0.0sec 19.21% 19.21% 0.0(0.0) 3.3

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:19.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Roaring Blaze 4.2 1.8 0.0sec 0.0sec 12.47% 23.34% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.24%
  • roaring_blaze_2:2.94%
  • roaring_blaze_3:1.29%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Roaring Blaze 4.2 1.8 0.0sec 0.0sec 12.57% 23.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.38%
  • roaring_blaze_2:2.90%
  • roaring_blaze_3:1.29%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:99.87%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Roaring Blaze 4.6 2.1 0.0sec 0.0sec 13.16% 21.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.00%
  • roaring_blaze_2:3.72%
  • roaring_blaze_3:1.44%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Roaring Blaze 5.3 4.7 0.0sec 0.0sec 11.90% 30.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:6.00%
  • roaring_blaze_2:4.11%
  • roaring_blaze_3:1.45%
  • roaring_blaze_4:0.33%
  • roaring_blaze_5:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 2988536.59
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 12415
death count pct 124.11
avg death time 300.56
min death time 214.57
max death time 375.75
dmg taken 899102817.00

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 300.78
Minimum 214.57
Maximum 375.75
Spread ( max - min ) 161.18
Range [ ( max - min ) / 2 * 100% ] 26.79%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 2998900.59
Minimum 2798924.60
Maximum 3355985.98
Spread ( max - min ) 557061.38
Range [ ( max - min ) / 2 * 100% ] 9.29%
Standard Deviation 81562.5825
5th Percentile 2874008.17
95th Percentile 3132499.87
( 95th Percentile - 5th Percentile ) 258491.70
Mean Distribution
Standard Deviation 815.6666
95.00% Confidence Intervall ( 2997301.91 - 3000499.26 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2842
0.1 Scale Factor Error with Delta=300 56789181
0.05 Scale Factor Error with Delta=300 227156724
0.01 Scale Factor Error with Delta=300 5678918095
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2496
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 718753688 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

Fluffy_Pillow_Beast1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Beast1: Eradication 1.2 1.0 0.0sec 0.0sec 20.98% 20.98% 1.0(1.0) 0.7

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:20.98%

Trigger Attempt Success

  • trigger_pct:99.61%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 1.4 1.7 0.0sec 0.0sec 23.93% 23.93% 1.7(1.7) 0.8

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:23.93%

Trigger Attempt Success

  • trigger_pct:98.99%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 1.2 0.8 0.0sec 0.0sec 20.02% 20.02% 0.8(0.8) 0.6

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:20.02%

Trigger Attempt Success

  • trigger_pct:97.10%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 2.1 2.2 0.0sec 0.0sec 30.53% 30.53% 2.2(2.2) 0.6

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:30.53%

Trigger Attempt Success

  • trigger_pct:99.28%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 1.5 1.7 0.0sec 0.0sec 24.23% 24.23% 1.7(1.7) 0.7

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:24.23%

Trigger Attempt Success

  • trigger_pct:99.02%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 1.1 0.7 0.0sec 0.0sec 15.84% 15.84% 0.7(0.7) 0.6

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:15.84%

Trigger Attempt Success

  • trigger_pct:93.46%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Eradication 2.3 2.8 0.0sec 0.0sec 32.71% 32.71% 2.8(2.8) 0.5

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:32.71%

Trigger Attempt Success

  • trigger_pct:99.25%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 27.55% 27.55% 0.0(0.0) 1.3

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 27.75% 27.75% 0.0(0.0) 1.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 27.36% 27.36% 0.0(0.0) 1.2

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 44.86% 44.86% 0.0(0.0) 0.1

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:44.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 27.82% 27.82% 0.0(0.0) 1.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 27.85% 27.85% 0.0(0.0) 1.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Havoc 1.8 0.0 0.0sec 0.0sec 44.73% 44.73% 0.0(0.0) 0.1

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:44.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Beast1: Roaring Blaze 1.8 0.1 0.0sec 0.0sec 19.33% 38.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:18.38%
  • roaring_blaze_2:0.76%
  • roaring_blaze_3:0.21%

Trigger Attempt Success

  • trigger_pct:95.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Roaring Blaze 2.4 0.2 0.0sec 0.0sec 31.74% 54.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:29.68%
  • roaring_blaze_2:1.74%
  • roaring_blaze_3:0.33%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:99.73%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Roaring Blaze 1.9 0.2 0.0sec 0.0sec 23.15% 45.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:21.41%
  • roaring_blaze_2:1.54%
  • roaring_blaze_3:0.20%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:97.59%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Beast1: Roaring Blaze 2.9 0.7 0.0sec 0.0sec 34.20% 80.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:30.62%
  • roaring_blaze_2:2.76%
  • roaring_blaze_3:0.61%
  • roaring_blaze_4:0.20%
  • roaring_blaze_5:0.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Beast1
Resource RPS-Gain RPS-Loss
Health 0.00 2022290.00
Combat End Resource Mean Min Max
Health 884858242.34 689815778.24 1071883476.67

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Beast1 Fight Length
Count 9999
Mean 45.07
Minimum 20.31
Maximum 82.56
Spread ( max - min ) 62.25
Range [ ( max - min ) / 2 * 100% ] 69.06%
DPS
Sample Data Beast1 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Beast1 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Beast1 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Beast1 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Beast1 Damage Taken Per Second
Count 9999
Mean 2027097.88
Minimum 1242299.53
Maximum 3184297.88
Spread ( max - min ) 1941998.35
Range [ ( max - min ) / 2 * 100% ] 47.90%
HPS
Sample Data Beast1 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Beast1 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Beast1 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Beast1 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Beast1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Beast1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Beast1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 718765667 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Beast1"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Heavy_Spear1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Heavy_Spear1: Eradication 1.6 1.2 0.0sec 0.0sec 5.74% 5.74% 1.2(1.2) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:5.74%

Trigger Attempt Success

  • trigger_pct:92.89%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 1.8 2.2 0.0sec 0.0sec 7.25% 7.25% 2.2(2.2) 1.1

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:7.25%

Trigger Attempt Success

  • trigger_pct:95.87%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 1.6 1.3 0.0sec 0.0sec 6.01% 6.01% 1.3(1.3) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:6.01%

Trigger Attempt Success

  • trigger_pct:95.23%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 4.3 4.7 0.0sec 0.0sec 13.91% 13.91% 4.7(4.7) 1.2

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:13.91%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 1.9 2.0 0.0sec 0.0sec 7.26% 7.26% 2.0(2.0) 1.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:7.26%

Trigger Attempt Success

  • trigger_pct:96.02%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 1.5 1.1 0.0sec 0.0sec 5.11% 5.11% 1.1(1.1) 0.7

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:5.11%

Trigger Attempt Success

  • trigger_pct:89.49%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Eradication 5.3 4.9 0.0sec 0.0sec 15.67% 15.67% 4.9(4.9) 1.9

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:15.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Havoc 2.0 0.0 0.0sec 0.0sec 7.36% 7.36% 0.0(0.0) 1.9

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:7.36%

Trigger Attempt Success

  • trigger_pct:97.43%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.0 0.0 0.0sec 0.0sec 7.33% 7.33% 0.0(0.0) 1.9

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:7.33%

Trigger Attempt Success

  • trigger_pct:97.12%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.0 0.0 0.0sec 0.0sec 7.45% 7.45% 0.0(0.0) 1.9

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:7.45%

Trigger Attempt Success

  • trigger_pct:97.95%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.0 0.0 0.0sec 0.0sec 13.39% 13.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:13.39%

Trigger Attempt Success

  • trigger_pct:97.47%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.1 0.0 0.0sec 0.0sec 7.63% 7.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:7.63%

Trigger Attempt Success

  • trigger_pct:97.50%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.1 0.0 0.0sec 0.0sec 7.75% 7.75% 0.0(0.0) 2.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:7.75%

Trigger Attempt Success

  • trigger_pct:96.63%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Havoc 2.3 0.0 0.0sec 0.0sec 15.01% 15.01% 0.0(0.0) 0.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:15.01%

Trigger Attempt Success

  • trigger_pct:98.24%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear1: Roaring Blaze 1.6 0.7 0.0sec 0.0sec 7.09% 14.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:4.94%
  • roaring_blaze_2:1.70%
  • roaring_blaze_3:0.45%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:88.81%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Roaring Blaze 1.7 1.1 0.0sec 0.0sec 8.19% 14.94% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:4.52%
  • roaring_blaze_2:3.05%
  • roaring_blaze_3:0.62%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:94.53%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Roaring Blaze 1.6 0.7 0.0sec 0.0sec 7.01% 14.19% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:4.91%
  • roaring_blaze_2:1.67%
  • roaring_blaze_3:0.43%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:88.49%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear1: Roaring Blaze 4.3 3.6 0.0sec 0.0sec 11.00% 27.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:5.62%
  • roaring_blaze_2:4.19%
  • roaring_blaze_3:0.96%
  • roaring_blaze_4:0.23%
  • roaring_blaze_5:0.00%

Trigger Attempt Success

  • trigger_pct:99.86%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Heavy_Spear1
Resource RPS-Gain RPS-Loss
Health 0.00 657720.11
Combat End Resource Mean Min Max
Health 893568493.43 705084343.33 1074165996.88

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Heavy_Spear1 Fight Length
Count 9999
Mean 216.31
Minimum 150.00
Maximum 270.75
Spread ( max - min ) 120.75
Range [ ( max - min ) / 2 * 100% ] 27.91%
DPS
Sample Data Heavy_Spear1 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Heavy_Spear1 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Heavy_Spear1 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Heavy_Spear1 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Heavy_Spear1 Damage Taken Per Second
Count 9999
Mean 660243.50
Minimum 383296.46
Maximum 994668.70
Spread ( max - min ) 611372.25
Range [ ( max - min ) / 2 * 100% ] 46.30%
HPS
Sample Data Heavy_Spear1 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Heavy_Spear1 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Heavy_Spear1 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Heavy_Spear1 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Heavy_Spear1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Heavy_Spear1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Heavy_Spear1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 718765667 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Heavy_Spear1"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Heavy_Spear2 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Heavy_Spear2: Eradication 2.6 1.1 0.0sec 0.0sec 6.89% 6.89% 1.1(1.1) 1.4

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:6.89%

Trigger Attempt Success

  • trigger_pct:96.20%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 4.4 1.9 0.0sec 0.0sec 9.82% 9.82% 1.9(1.9) 1.9

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:9.82%

Trigger Attempt Success

  • trigger_pct:99.69%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 2.6 1.1 0.0sec 0.0sec 6.85% 6.85% 1.1(1.1) 1.4

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:6.85%

Trigger Attempt Success

  • trigger_pct:96.13%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 5.4 4.9 0.0sec 0.0sec 11.98% 11.98% 4.9(4.9) 1.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:11.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 5.2 3.6 0.0sec 0.0sec 11.32% 11.32% 3.6(3.6) 1.6

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:11.32%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 2.7 1.9 0.0sec 0.0sec 7.20% 7.20% 1.9(1.9) 0.9

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:7.20%

Trigger Attempt Success

  • trigger_pct:96.41%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Eradication 5.5 7.1 0.0sec 0.0sec 13.33% 13.33% 7.1(7.1) 0.7

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Havoc 7.0 0.0 0.0sec 0.0sec 19.21% 19.21% 0.0(0.0) 3.3

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:19.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 7.0 0.0 0.0sec 0.0sec 19.53% 19.53% 0.0(0.0) 3.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:19.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 7.0 0.0 0.0sec 0.0sec 19.19% 19.19% 0.0(0.0) 3.3

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:19.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 6.9 0.0 0.0sec 0.0sec 27.74% 27.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:27.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 6.9 0.0 0.0sec 0.0sec 19.08% 19.08% 0.0(0.0) 3.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/SC
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:19.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 6.8 0.0 0.0sec 0.0sec 18.79% 18.79% 0.0(0.0) 3.3

Buff details

  • buff initial source:BD/ELT/SH/Sac/CDF
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:18.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Havoc 6.6 0.0 0.0sec 0.0sec 26.91% 26.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:BD/ELT/SH/Sac/WH
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:26.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Heavy_Spear2: Roaring Blaze 4.2 1.8 0.0sec 0.0sec 12.47% 23.34% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Serv/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.24%
  • roaring_blaze_2:2.94%
  • roaring_blaze_3:1.29%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Roaring Blaze 4.6 2.1 0.0sec 0.0sec 13.16% 21.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/SC
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.00%
  • roaring_blaze_2:3.72%
  • roaring_blaze_3:1.44%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Roaring Blaze 4.2 1.8 0.0sec 0.0sec 12.57% 23.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/CDF
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.38%
  • roaring_blaze_2:2.90%
  • roaring_blaze_3:1.29%
  • roaring_blaze_4:0.00%

Trigger Attempt Success

  • trigger_pct:99.87%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Heavy_Spear2: Roaring Blaze 5.3 4.7 0.0sec 0.0sec 11.90% 30.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:RB/ELT/SH/Sac/WH
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:6.00%
  • roaring_blaze_2:4.11%
  • roaring_blaze_3:1.45%
  • roaring_blaze_4:0.33%
  • roaring_blaze_5:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Heavy_Spear2
Resource RPS-Gain RPS-Loss
Health 0.00 748429.75
Combat End Resource Mean Min Max
Health 889461749.20 703435447.97 1074616033.53

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Heavy_Spear2 Fight Length
Count 9999
Mean 216.31
Minimum 150.00
Maximum 270.75
Spread ( max - min ) 120.75
Range [ ( max - min ) / 2 * 100% ] 27.91%
DPS
Sample Data Heavy_Spear2 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Heavy_Spear2 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Heavy_Spear2 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Heavy_Spear2 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Heavy_Spear2 Damage Taken Per Second
Count 9999
Mean 746736.90
Minimum 466896.08
Maximum 1060882.52
Spread ( max - min ) 593986.44
Range [ ( max - min ) / 2 * 100% ] 39.77%
HPS
Sample Data Heavy_Spear2 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Heavy_Spear2 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Heavy_Spear2 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Heavy_Spear2 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Heavy_Spear2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Heavy_Spear2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Heavy_Spear2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 718765667 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Heavy_Spear2"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast1
Resource RPS-Gain RPS-Loss
Health 0.00 836999.44
Combat End Resource Mean Min Max
Health 893801726.58 712341803.68 1074206310.95

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast1 Fight Length
Count 9999
Mean 98.33
Minimum 70.00
Maximum 120.75
Spread ( max - min ) 50.75
Range [ ( max - min ) / 2 * 100% ] 25.81%
DPS
Sample Data Pack_Beast1 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast1 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Pack_Beast1 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast1 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast1 Damage Taken Per Second
Count 9999
Mean 840881.94
Minimum 706403.12
Maximum 997323.83
Spread ( max - min ) 290920.71
Range [ ( max - min ) / 2 * 100% ] 17.30%
HPS
Sample Data Pack_Beast1 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Pack_Beast1 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast1 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast1 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Pack_Beast1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Pack_Beast1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 718765667 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast1"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast2 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast2
Resource RPS-Gain RPS-Loss
Health 0.00 758868.24
Combat End Resource Mean Min Max
Health 894186579.88 711771874.02 1074247447.75

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast2 Fight Length
Count 9999
Mean 98.33
Minimum 70.00
Maximum 120.75
Spread ( max - min ) 50.75
Range [ ( max - min ) / 2 * 100% ] 25.81%
DPS
Sample Data Pack_Beast2 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast2 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Pack_Beast2 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast2 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast2 Damage Taken Per Second
Count 9999
Mean 762170.45
Minimum 637829.22
Maximum 899140.41
Spread ( max - min ) 261311.20
Range [ ( max - min ) / 2 * 100% ] 17.14%
HPS
Sample Data Pack_Beast2 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Pack_Beast2 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast2 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast2 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Pack_Beast2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Pack_Beast2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 718765667 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast2"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast3 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast3
Resource RPS-Gain RPS-Loss
Health 0.00 708695.70
Combat End Resource Mean Min Max
Health 894581574.89 712946463.65 1074247447.75

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast3 Fight Length
Count 9999
Mean 98.33
Minimum 70.00
Maximum 120.75
Spread ( max - min ) 50.75
Range [ ( max - min ) / 2 * 100% ] 25.81%
DPS
Sample Data Pack_Beast3 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast3 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Pack_Beast3 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast3 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast3 Damage Taken Per Second
Count 9999
Mean 711992.24
Minimum 585072.10
Maximum 866142.05
Spread ( max - min ) 281069.95
Range [ ( max - min ) / 2 * 100% ] 19.74%
HPS
Sample Data Pack_Beast3 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Pack_Beast3 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast3 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast3 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Pack_Beast3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Pack_Beast3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 718765667 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast3"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast4 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast4
Resource RPS-Gain RPS-Loss
Health 0.00 658036.07
Combat End Resource Mean Min Max
Health 895002186.05 712996896.76 1074247447.75

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast4 Fight Length
Count 9999
Mean 98.33
Minimum 70.00
Maximum 120.75
Spread ( max - min ) 50.75
Range [ ( max - min ) / 2 * 100% ] 25.81%
DPS
Sample Data Pack_Beast4 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast4 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Pack_Beast4 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast4 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast4 Damage Taken Per Second
Count 9999
Mean 661448.61
Minimum 531329.94
Maximum 812166.55
Spread ( max - min ) 280836.61
Range [ ( max - min ) / 2 * 100% ] 21.23%
HPS
Sample Data Pack_Beast4 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Pack_Beast4 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast4 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast4 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast4 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Pack_Beast4Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Pack_Beast4 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 718765667 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast4"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast5 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast5
Resource RPS-Gain RPS-Loss
Health 0.00 629963.24
Combat End Resource Mean Min Max
Health 895327435.84 712925641.71 1074299376.50

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast5 Fight Length
Count 9999
Mean 98.33
Minimum 70.00
Maximum 120.75
Spread ( max - min ) 50.75
Range [ ( max - min ) / 2 * 100% ] 25.81%
DPS
Sample Data Pack_Beast5 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast5 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Pack_Beast5 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast5 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast5 Damage Taken Per Second
Count 9999
Mean 633397.35
Minimum 516095.39
Maximum 776219.43
Spread ( max - min ) 260124.03
Range [ ( max - min ) / 2 * 100% ] 20.53%
HPS
Sample Data Pack_Beast5 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Pack_Beast5 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast5 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast5 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast5 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Pack_Beast5Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Pack_Beast5 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 718765667 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast5"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast6 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast6
Resource RPS-Gain RPS-Loss
Health 0.00 617009.19
Combat End Resource Mean Min Max
Health 895439007.37 713511025.83 1074247447.75

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast6 Fight Length
Count 9999
Mean 98.33
Minimum 70.00
Maximum 120.75
Spread ( max - min ) 50.75
Range [ ( max - min ) / 2 * 100% ] 25.81%
DPS
Sample Data Pack_Beast6 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast6 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Pack_Beast6 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast6 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast6 Damage Taken Per Second
Count 9999
Mean 620423.51
Minimum 495892.37
Maximum 774756.22
Spread ( max - min ) 278863.85
Range [ ( max - min ) / 2 * 100% ] 22.47%
HPS
Sample Data Pack_Beast6 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Pack_Beast6 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast6 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast6 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast6 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Pack_Beast6Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Pack_Beast6 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 718765667 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast6"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.